KEGG   Leishmania major: LMJF_28_2780Help
Entry
LMJF_28_2780      CDS       T01014                                 

Definition
(RefSeq) putative heat-shock protein hsp70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lma  Leishmania major
Pathway
lma03040  Spliceosome
lma04141  Protein processing in endoplasmic reticulum
lma04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LMJF_28_2780
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LMJF_28_2780
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LMJF_28_2780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lma01009]
    LMJF_28_2780
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lma03041]
    LMJF_28_2780
   03009 Ribosome biogenesis [BR:lma03009]
    LMJF_28_2780
   03110 Chaperones and folding catalysts [BR:lma03110]
    LMJF_28_2780
   04131 Membrane trafficking [BR:lma04131]
    LMJF_28_2780
   03051 Proteasome [BR:lma03051]
    LMJF_28_2780
   03029 Mitochondrial biogenesis [BR:lma03029]
    LMJF_28_2780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lma04147]
    LMJF_28_2780
Protein phosphatases and associated proteins [BR:lma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LMJF_28_2780
Spliceosome [BR:lma03041]
 Complex B
  Other components
   Prp19 complex
    LMJF_28_2780
 Complex C
   Prp19-CDC5 complex
    LMJF_28_2780
Ribosome biogenesis [BR:lma03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    LMJF_28_2780
Chaperones and folding catalysts [BR:lma03110]
 Heat shock proteins
  HSP70 / DNAK
   LMJF_28_2780
Membrane trafficking [BR:lma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    LMJF_28_2780
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LMJF_28_2780
Proteasome [BR:lma03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LMJF_28_2780
Mitochondrial biogenesis [BR:lma03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    LMJF_28_2780
Exosome [BR:lma04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMJF_28_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 5653493
NCBI-ProteinID: XP_001684564
GeneDB: LmjF.28.2780
UniProt: Q4Q7Y4
Position
28:complement(1060574..1062550)
Genome map
AA seq 658 aa AA seqDB search
MTFDGAIGIDLGTTYSCVGVWQNERVDIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKPVISVQYRGEEKTFTPEEI
SSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAA
AIAYGLDKGDDGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGEDFDNRLV
TFFTEEFKRKNKGKNLASSHRALRRLRTACERAKRTLSSATQATIEIDALFENIDFQATI
TRARFEELCGDLFRSTIQPVERVLQDAKMDKRSVHDVVLVGGSTRIPKVQSLVSDFFGGK
ELNKSINPDEAVAYGAAVQAFILTGGKSKQTEGLLLLDVTPLTLGIETAGGVMTALIKRN
TTIPTKKSQIFSTYADNQPGVHIQVFEGERAMTKDCHLLGTFDLSGIPPAPRGVPQIEVT
FDLDANGILNVSAEEKGTGKRNQITITNDKGRLSKDEIERMVNDAMKYEEDDKAQRDRVE
AKNGLENYAYSMKNTLSDSNVSGKLDDSDKATLNKEIDAALEWLSSNQEATKEEYEHRQK
ELESVCNPIMTKMYQSMGGAAGGMPGGMPGGMPDMSGMSGGAGPAGGASSGPKVEEVD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgacggcgccatcggcatcgacctgggcacgacgtactcgtgcgtaggcgtg
tggcagaacgaacgcgtggatatcatcgcgaacgaccagggtaaccgcacgacaccgtcg
tacgttgcgttcacggactcggagcggctgatcggcgatgctgcaaagaaccaggtggca
atgaacccgcacaacacggtgttcgacgcgaagcgcctgattggccgcaagttcaacgac
tcggttgtgcagtcggacatgaagcactggccgttcaaggtgacgacgaagggtgacgac
aagcccgtgatttcggtgcagtaccgcggcgaggagaagaccttcacgccggaggagatc
agctcgatggtgctgctgaagatgaaggagacggcggaggcgtacctgggcaagcaggtg
aagaaggccgtggtgacggtgccggcgtacttcaacgactcgcagcgccaggcaacgaag
gacgccggcacgattgctggcctggaggtgctgcgcatcatcaacgagccgacggcagcg
gccatcgcgtacggtctggacaagggcgacgacggcaaggagcgcaacgtgctgatcttc
gaccttggcggcggcacgtttgatgtgacgctgctgacgatcgacggcggcatcttcgag
gtgaaggcgacgaacggcgatacacaccttggcggcgaggacttcgacaaccgcctcgtc
acgttcttcaccgaggagttcaagcgcaagaacaagggtaagaacctggcgtcgagccac
cgcgcgctgcgccgtctgcgcacggcgtgcgagcgcgcgaagcgcacgctgtcgtccgcg
acgcaggcgacgatcgagatcgacgcgctgttcgagaacattgacttccaggccaccatc
acgcgcgcgcgcttcgaggagctgtgcggcgacctgttccgcagcacgatccagccggtg
gagcgcgtgctgcaggacgcgaagatggacaagcgctccgtgcacgacgtggtgctggtg
ggcgggtcaacgcgcatcccgaaggtgcagtccctcgtgtcggacttcttcggcggcaag
gagctgaacaagagcatcaaccccgacgaggctgtcgcgtacggcgctgcggtgcaggcc
ttcatcctgacgggcggcaagagcaagcagacggagggcctgctgctgctggacgtgacg
ccgctgacgctgggcatcgagacggccggcggcgtgatgacggcgctgatcaagcgcaac
acgacgatcccgaccaagaagagccagatcttctcgacgtacgcggacaaccagcccggc
gtgcacatccaggtcttcgagggcgagcgcgcgatgacgaaggactgccacctgctgggc
acgttcgacctgtccggcatcccgccggcgccgcgcggcgtaccgcagatcgaggtgacg
ttcgacctggacgcaaacggcatcctgaacgtgtccgcggaggagaagggcaccggcaag
cgcaaccagatcaccatcaccaacgacaagggccggctgagcaaggacgagatcgagcgc
atggtgaacgacgcgatgaagtacgaggaggacgacaaggcacagcgcgaccgcgtggag
gcaaagaacggcctggagaactacgcgtactcgatgaagaacacgctcagcgactcgaac
gtgtccggcaagctggacgatagcgacaaggccacgctgaacaaggagatcgacgcggcg
ctggagtggctgagcagcaaccaggaggcgacgaaggaggagtacgagcacaggcagaag
gagctggagagcgtatgcaacccgatcatgaccaagatgtaccagagcatgggcggtgct
gcgggcggcatgcccggcggcatgcccggcggtatgccggacatgagcggcatgagcggt
ggtgcaggcccggccggcggtgcgtcctctggccccaaggtcgaggaggtcgactaa

DBGET integrated database retrieval system