KEGG   Leishmania major: LMJF_29_2540Help
Entry
LMJF_29_2540      CDS       T01014                                 

Definition
(RefSeq) hypothetical protein
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
lma  Leishmania major
Brite
KEGG Orthology (KO) [BR:lma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lma03016]
    LMJF_29_2540
Enzymes [BR:lma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     LMJF_29_2540
Transfer RNA biogenesis [BR:lma03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    LMJF_29_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ Methyltr_RsmF_N
Motif
Other DBs
NCBI-GeneID: 12981114
NCBI-ProteinID: XP_003722337
GeneDB: LmjF.29.2540
UniProt: E9AEB6
Position
29:1098157..1100073
Genome map
AA seq 638 aa AA seqDB search
MSRNQNRKGGSKRGRADEWMTDVRDPAALQNTAFEAYYKGNVIPASEWEAFMACLQTGLP
MSIRFNCAVPQVDAVDAFVTQHLSEVFESTRIPFFPAQRAIQFGVSRGDLKRKKANRTLK
KIVSAMNEGGYLTRQETVSMLPPLLLQVESGMRVLDMCAAPGSKTSQVLELLLAGESGRG
VVVANDVKASRLDVLHHQTNRAAGAHLHLIITNTDATRFPLLPLAERFDRVLCDVMCSGD
GTLRKSIDMWPRWDSLQGANLHHTQMRVLLRGMASCKSGGIVVYSTCSLNPVEDEAVVSA
CLAQTEGTFELIDPTPLHHGLCASPGMTSWTVTTRDLTTALRNYEDAKAFMEAQTDRRTF
QYAPTMFANTELLVDQHIERTRRILPHTQDTGGFFVAALRCVAAVPEDARARAESAADAK
GTEAPLKPLSAGMRATLQKALALPETFPYDNLIVRNEEARNQKVYLANSDAISLSQQLGC
RVVHVGSKVFESVLKYSNEKLRFCTDGVADLVPFLPANFLVSVTPSLLLELAAETPMPYA
DFSAKTGQLIEELPPSFVLTTSWAVGGPIYVAAEKSTKLGKLVAHVAGWQVTVCKLALGL
PLVESVEEEQEDAAEEGDAARENASALTADAATHYKDG
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaatcagaaccgcaagggcggcagcaagcgcggccgcgcagatgagtggatg
accgacgtgcgcgacccggcagcgttgcagaacacggcttttgaggcgtactacaagggc
aacgtcatccctgcatcggagtgggaggcgtttatggcgtgcctgcagacggggctgccc
atgtcgatccggttcaactgcgcagtgccacaggtggacgccgtggacgcgttcgtcacg
cagcacctctctgaagtcttcgagagcacgcgcatcccgttcttcccggcgcagcgagcg
attcagtttggcgtcagccgcggcgacttgaagcgcaagaaggcgaaccggacgctgaag
aagattgtctccgcgatgaacgagggcggctacctgactcggcaggagaccgtcagcatg
ctgcctcctctcctgctgcaggtggagtctgggatgcgggtgctggacatgtgcgccgcg
ccgggaagcaagacatcgcaggtcctcgagctcctccttgctggcgagtccgggagggga
gttgtggtggcgaacgacgtcaaagcttctcgcttggacgtgctgcatcatcaaaccaac
cgtgccgctggtgcacatctccacctcatcatcacaaacacagacgccacgcgctttcct
ttgctgccactggcggagcgcttcgatcgcgtcttgtgcgacgtgatgtgctccggtgat
ggaacgctgcgcaagtccatcgatatgtggcctcgatgggactctctccagggagccaac
ctacaccacacccagatgcgcgtgttgctgcgcggcatggcgtcttgcaaatcgggtggt
attgtggtgtactcaacctgcagcctcaaccccgtcgaggacgaagcagttgtgtccgct
tgcctggcgcagacggagggcaccttcgagctgatagaccctacgccgctgcaccacggg
ctctgcgcttcgcctggcatgacttcatggaccgtcaccacacgcgacctcaccacggcg
ctgcgcaattacgaggacgcgaaggcgttcatggaggcccagacggatcgccgcacgttt
cagtacgcaccgactatgttcgcgaacaccgagctgctcgtggatcagcacatcgagcgc
acccgccgcatcctgccccacacgcaggacaccggcggcttctttgtggcggcgctgcgt
tgtgtcgcggcagtgccggaggatgcgcgtgcgagggctgagtccgccgctgatgcgaag
ggcacggaggcgcccttgaaacccctctcggctggtatgcgggcgaccctgcagaaggcg
ctcgcgctgcccgaaacgttcccttatgacaacctcatcgtgcgcaacgaggaggcgcgt
aaccagaaggtgtacctggccaactcggacgccatttcactcagccagcaactgggctgt
cgcgtcgtgcacgtcggctcgaaggtgttcgagtccgtgctaaagtacagcaacgaaaag
ctgcgcttctgcacagacggcgtagccgacctcgtgccctttctgcccgccaacttcctt
gtatcggtaacgccgtccctgctgctggagctggctgctgagacgccgatgccgtacgcc
gattttagcgccaagactggacagctcatcgaggagctgccaccgagttttgtcctcacc
acctcctgggcggttggggggcctatctacgtagctgcagagaagtccacgaagctgggc
aagcttgttgcgcacgtagcaggctggcaagtgacagtgtgcaagctggctttgggctta
ccactggtggagtcggtggaggaggagcaggaggacgctgcagaggagggcgacgcggcc
agagagaacgcctctgcgctgaccgcagatgcggcgacgcactacaaagacggctaa

DBGET integrated database retrieval system