KEGG   Leishmania major: LMJF_31_2340Help
Entry
LMJF_31_2340      CDS       T01014                                 

Definition
(RefSeq) putative p-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LMJF_31_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like PGP_phosphatase Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 5654166
NCBI-ProteinID: XP_001685221
GeneDB: LmjF.31.2340
UniProt: Q4Q627
Position
31:complement(1152129..1153469)
Genome map
AA seq 446 aa AA seqDB search
MSPPASAVCSACARPSGVPRSRASQQLCLQTPLHEAGKSAVCRREGVLSALLFHSPPLSV
PVTALGSPCADRNNAPPENLSAMPERMTAALAARLVASPLKYVLLDIDGVIWCGGHVIDR
VPETLQYLRGQGKQIRFLSNNASFSREQLMQSLKAKGIEGVTVEECYNSAYTAALRLRQM
LGKADVPGEEPLVHGNVFVIGEQGLHDELQQVLAPGFITYGVELHDAVRAGGYDTDALGS
AWRVPCLPPPQKRLVVCNGKACRMVQAGTNSAEKISLSDLNAAAVVVGLDKHFNIVKLAY
GSLVLQGPPKDLREESYTPPLFVATNEDPQLPVGRDGTMIPGAGSMVSALCTAVGKRPDA
VCGKPHKDMANILFAAEGVTNPREECIMIGDRLTTDVAFGNAAGCQSMLVLSGAEGLADV
EEAEKQGRTALVPKYVAESLACFLPL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctccggcttcagcggtatgctctgcttgcgccaggccctctggtgtcccccgc
tcaagagcgtcgcagcagctctgcctgcaaacgcctttacatgaggccggcaaatccgcc
gtgtgccgccgtgaaggcgtgctctctgcgctcctgtttcattccccccccctttccgtc
cccgtcactgcactggggtctccctgcgctgacagaaataacgcgccaccagagaacctt
tccgcgatgccagagcgaatgacagcagcgctggctgcacgactcgtggcctcgccgctg
aagtacgtgctgctcgacattgacggcgtgatctggtgcggcgggcacgtgatcgaccgt
gtgccagagacgctgcagtacctgcgcggccaaggcaagcaaatccgctttctctcgaac
aacgcgtcgttctctcgcgagcagttgatgcagagcctcaaggccaagggaatcgagggt
gtgacagtggaagagtgctacaacagcgcgtacacggcggcgctgcgactgaggcagatg
ttgggtaaggcagacgtgcctggcgaggagccgctggtgcacggaaatgtgttcgtgatt
ggtgagcaggggctgcacgatgagctgcagcaagtacttgccccggggttcatcacttac
ggtgtggagctgcacgatgcggtgcgcgctggagggtacgacacggatgcgcttggcagc
gcgtggcgcgttccgtgcctgccgccaccgcagaagcgcctggtggtgtgcaacggcaag
gcgtgccgcatggtgcaggccggcactaacagtgcggagaagatttcgctctccgacctg
aacgccgctgctgtcgtcgtcgggcttgacaagcatttcaacatcgttaagctggcgtac
gggtcacttgttctgcaagggccgccgaaggacctgcgagaggagtcgtacacgccgcct
ctgttcgtggccacgaacgaggatccacagctgccggtcggtcgcgatggcaccatgatc
ccaggcgctgggtccatggtgagcgctctgtgcaccgctgtcggaaagcggccggatgcc
gtctgcgggaagcctcacaaggacatggcgaatatattgttcgcggccgagggtgtcacg
aatccgcgagaggagtgcatcatgatcggtgaccggctgaccacggatgtggcgtttggc
aatgcggccggatgccagagcatgctagtgctgagcggcgccgaagggttggcggatgtg
gaggaggcggagaagcaaggcaggaccgctctggtgccaaaatacgttgccgagtctctc
gcctgcttcttgccactatga

DBGET integrated database retrieval system