KEGG   Leishmania major: LMJF_31_2970Help
Entry
LMJF_31_2970      CDS       T01014                                 

Definition
(RefSeq) putative acetyl-CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
lma  Leishmania major
Pathway
lma00061  Fatty acid biosynthesis
lma00620  Pyruvate metabolism
lma00640  Propanoate metabolism
lma01100  Metabolic pathways
lma01110  Biosynthesis of secondary metabolites
lma01130  Biosynthesis of antibiotics
lma01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMJF_31_2970
   00640 Propanoate metabolism
    LMJF_31_2970
  Lipid metabolism
   00061 Fatty acid biosynthesis
    LMJF_31_2970
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    LMJF_31_2970
Enzymes [BR:lma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     LMJF_31_2970
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LMJF_31_2970
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LMJF_31_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans ACC_central CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5654235
NCBI-ProteinID: XP_001685287
GeneDB: LmjF.31.2970
UniProt: Q4Q5W1
Position
31:complement(1395180..1401686)
Genome map
AA seq 2168 aa AA seqDB search
MKAMQETSSPVGFRYDSMEQLCSSLGAIMPIKRLLIANNGLAAVKGMDSIRSWMYEHTGD
SEAVQFVVMATPEDLKANAEFISLADKHIPVPGGMNSNNYANVDVIMQTALQNMCDAIYP
GWGHASENSALPRECMKSKRVTFLGPSEDAMFALGDKIASTIVAQSNGVPTVPWSGDSIR
LPPKTFSVDAAAYEKAYVNSPEECEEVCRRIGFPVMIKASEGGGGKGIRSCKCLKDVKNL
FFAVSEEVKGCHIFVMRMLENVRHLEVQLLADCYGHCIAVRTRDCSVQRRHQKIIEEGPA
FGVDPAIITAMESAAIQLACAVKYCGLGTVEYMYDKETHKFYFLELNPRIQVEHPVSEMI
SGVNLPAALFCVGMGIPLDRIPEVRAFYGEDPYGTTPIDFSARQSVPPKCHTIAVRVTAE
DTDEGFRPTSGKVEEIAFKNSKECWGYFSVGSGGEIHQYADSQFGHIFSSGETREEARRG
MVLALRKLVVRGEIRTSTSYAMDLLETPAFRDCDVSTAWLDGMIAKKAAEAPAHQRSIHS
ALIAASIYRNMRWMQEHKDKYIAFLAAGHVPSTEYLSNLHTESYVSRSEKYTLSAGMVSL
NEYAISLNGSIVLVPYRILKSGALQLTIGDKTLVAYVAEEPNSLRITIGGKVTNFSGDVD
PTKIMASVPGRLVRYVVDDDGHVNEDDAFAELEVMKMILPLRARTTGTLHHRAVPGTTIA
MGALLGEITPDDPSKVARPKEIKDPWPTELLVARQYERPDGVMRARRAAESLWLLVNGFH
FKEIPIEERVRRAFADLASLSLSSVTLKAVHLPFIPAEMCEETEARPQTPSEKYRAIIDA
IVDRYVTVEQPFDGHSRQEAIEGLRNTFDDNEAVFQIDFAHNQECHHYVMRSVLKYLEGN
ALLLKSLKGTLSKLVTLKSFAYGSLLLQARYLLRLCSLPSFTERKAQFAEALEEGSLRSL
VASSFGYDLLCSIMFDRQMEHLVHICLELFIRREYSGESEIEDLDILKQGTNWYASYNFD
PIEDAEVLHMTDELAVGSRRIIGGRGICVMLPDEKLLQSTLASSFRDVVSHYSDDIVIAT
VFFSVSRESTQSDVARMCRRLMEENAAVFQNFEKLETVYFMAHGMPEGPHFFTFRAETGF
QEDTLLRNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFKAAPKKAGASALEHRMFARV
AVTPHDMGMTPWTEATDVDVGHMLAKCLAALQVAHDDSTVKFPDSNHVFVKMIELTFDVR
SLQTLLVAAASSYQEKLTELGVRDVEVSFHVKVPSGLIPMRVIASSPSGYGVSVHVYYES
LSNGQLQLHRAETSEDVYYSSTGRPAELLLEMSLASPMMPPSRETPHLVRTASKLGDLRE
MLPSEKEQQISVDMMSEPTEARHRAITLGPYPQLEARDVKRLQARRAGTTYVHDWPAVLN
LILRKEWMKQRCALDLSQASIPKNPLRATELFLCEDGESLSTKKTFAQPCGMVVWMVEYA
PPRYFDMELKTAPTRRIVVVANDITFQSGSFAVPEDCVFKAASVLARAQHVPFVYISTNS
GARLGLSTEVKKRFLVEFTEKNDIAYLYLTKSDYEELRERKEIRMEVEPLEVKGETRYVI
KGVVGGPTEYIGVENLSGSGLVAGEMSKNYSEIPTISLVSGRSVGIGAYLNRLGRRVIQT
NDSPLILTGSGALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTHHDYGSARVLLRWLDY
VPAVLHPGRCTPHRLLWAAADPIDRDVTFCPTSNTQYDPRLLVTGLLGQTGLFDRGSWME
TLEGWARTVVVGRATLGGIPCGVILVETRLTKKFDPADPADPTSTSSFITQAGQVWFPDS
ARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLKFGASIVDNLRVYTAPVFIYI
PPGGELRGGAWVVVDPTINHNGVVEMYCEPSSRGGILEPSGVVEIKFRDDDVLQLIRRNR
PDLAAMEVKAAREAEKELLPYYRDVAVRFADLHDTYVRMKATGVVRDVVPWKDSRRHFYH
KLQRKLKELEVANDMLEGGVVGSLAGGVRKVEERYSAAHPNGPAWGTADQDQLKWLRGLD
GTWTGESNGHTVLNSSEWAKELQRLLTQNGGEESSMERALAKLFENPAIAKAAKVALDSS
ACAHSTAE
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatgcaggaaacgagttccccggtggggttccggtacgactccatggagcag
ctgtgtagctcgctcggggctatcatgccgatcaagcgccttcttattgccaacaacgga
ctcgccgccgtcaaggggatggactcgattcgatcatggatgtacgagcacacgggcgac
tccgaggcggtgcagttcgtggtgatggccactccagaggatctaaaggcgaacgccgaa
ttcatctcgctcgcggacaagcatattcctgttccgggcggcatgaacagcaacaactac
gcaaatgtggatgtcattatgcagacagcgctgcagaacatgtgtgacgccatctacccc
ggctggggccacgcctccgaaaactcggcgctgccgcgcgagtgcatgaagtccaaacgc
gtcacctttctaggcccgtctgaggatgccatgtttgcgttgggagacaagatcgcctca
acgattgtggcgcagtccaacggcgtaccgacggtgccgtggagcggcgacagcattcgc
ctccccccaaagaccttctctgtggacgccgcagcgtacgagaaggcgtacgtgaactcg
ccggaggagtgcgaggaggtgtgccgccgcatcggcttccccgtgatgatcaaggcgtct
gagggcggtggtggcaagggtatccgcagctgcaagtgtctgaaggatgtcaagaacttg
ttcttcgccgtgtccgaggaggtgaaaggctgccacatctttgtgatgcgcatgctggag
aatgtgcgtcacctggaggtgcagctgcttgccgactgctacggccactgcatcgccgtg
cgcacgcgtgactgcagcgtgcagcggcgccaccaaaagatcattgaggagggccccgcc
ttcggggtcgatcccgccatcatcacggcaatggaaagcgcggccattcagctggcctgt
gcggtgaagtactgcggtctcggcacggtggagtacatgtacgacaaggagacgcacaag
ttttactttttggagctgaacccgcgcatccaggtcgaacaccccgtctcggaaatgatc
tcgggcgtgaatctgccggctgccctcttctgcgtcggcatgggcatcccgctcgaccgc
attccggaggtgcgcgccttttacggcgaggacccgtacggcaccaccccgatcgacttc
tcggcccgccagagcgtaccgccgaagtgccatacgatcgcggtgcgcgtgacggccgag
gacacggacgaaggcttccggccgacctccggcaaggtggaggagattgccttcaagaac
agcaaggagtgctggggctacttctccgtcggctccggcggtgagattcatcagtacgcc
gactcgcagtttggccacatcttttcctccggtgagacccgcgaggaagcgcgccgcggg
atggtgctggcgctccgcaaacttgtcgtccgcggcgaaatccgcacgtcgacgtcgtac
gccatggatctgctagagacaccggctttccgcgactgcgatgtgagcacggcttggctg
gacggcatgatcgccaagaaggcggccgaagcgccggcgcaccagcgcagcatccactcc
gcgctgatcgccgccagcatctaccgcaacatgcgctggatgcaggaacacaaggacaag
tacattgccttcctcgccgccggccacgtgccgtccacggagtacctctccaaccttcac
accgagtcctacgtgagccgctcggagaagtacacgctgagcgccggtatggtgagcctc
aacgagtacgccatctccttgaacggcagtatcgtgctggtgccctaccgcatcctcaag
tctggtgccctgcaactgaccatcggcgacaagacccttgtcgcctacgtcgccgaggag
ccgaacagcctgcgcatcaccatcggcggcaaggtgacgaacttctccggcgacgttgac
ccgacgaaaattatggccagcgtccccggccgcctggtgcgctacgtcgtcgacgatgac
ggccacgtcaacgaagacgacgcgtttgccgagttggaggtgatgaagatgattctgccg
ctgcgggccaggactaccggtacattgcatcaccgcgccgtgccgggcacgaccatcgca
atgggcgcactgctgggcgagatcaccccggacgacccgagcaaggtcgctcgaccgaag
gagatcaaagacccgtggccgacggagctgcttgtcgcccgtcagtacgagcggccagac
ggcgttatgcgcgcgcgccgcgccgcggagtcgctgtggttgctcgtcaacggcttccat
ttcaaggagattccgattgaggagcgggtgcgcagggcgttcgccgacctcgcctcgctg
agtctctcatcggtcacgctcaaggcggtccacctgcccttcattccagccgagatgtgc
gaggagacggaggcgcgcccgcagacgccgagcgagaagtaccgcgccatcatcgacgcc
attgtggatcgctacgtcaccgtggagcagccctttgacgggcacagccggcaagaggcg
atcgaggggctgcgcaacaccttcgacgacaacgaggccgtcttccagatagactttgcg
cacaaccaggaatgccaccactacgtaatgcgcagcgtgctgaaatacctcgagggcaac
gcgctgcttctcaagtctctgaaagggacgctgtcgaagctggtcaccctcaagtccttc
gcgtatggctcgctgctgctgcaggcgcgctacctgctccgcttgtgctccttaccgtcc
ttcacggagcgcaaggcgcagttcgcggaggccctggaggagggcagcttacgtagcctc
gtcgccagcagtttcggctatgacctcctctgctccatcatgttcgaccgtcagatggag
cacctagtgcacatctgcctcgagctgttcattcgccgcgagtactctggcgagagcgag
atcgaggacctggacattttgaagcagggcaccaactggtacgccagctacaactttgac
cccatcgaggacgcggaagtgctgcacatgaccgacgagctggcggtggggtcgcggaga
ataatcggtgggcggggcatctgcgtcatgctgcccgatgagaagctgctccagtcgacg
ctagcctcgtctttccgcgatgttgtgtcacactacagcgacgacatcgtcatcgcgacc
gtcttcttctccgtttcgcgcgagtcgacgcagtcagacgtggcgcgcatgtgccgccgg
ctgatggaggagaacgcggccgtctttcagaacttcgaaaagcttgagacggtatacttc
atggcgcacgggatgccggaggggccgcatttcttcacgttccgggcggagacgggcttc
caggaggacacactgctgcgcaacgtgctgccacagtcggcacgtcgtctggagctcgac
cggctgtcgaactacgaggtgagcatgcacccgacaccctacaaggacgtacacgtgttc
aaggcggcccccaagaaggctggcgcgtccgcgctggagcaccgcatgttcgcgcgcgtg
gcggtgacgcctcacgacatgggcatgactccctggacggaggcgacggacgtggatgtg
ggccacatgctggccaagtgcctggcggcgctgcaggtagcccacgacgactcaacagtg
aagtttccggacagtaatcacgtgttcgtaaagatgattgagctgaccttcgacgtccgc
tcgctgcagaccctgctggtggcggcggccagctcataccaggagaagctgacggagttg
ggtgtgcgggatgtggaagtatcctttcacgtgaaggtgccgtcgggtctcattccaatg
cgtgtcatcgccagtagcccgtctggctatggcgtgtcggtgcatgtctactacgagtca
ctgtcgaacggccagctgcagctgcaccgtgccgagacgtctgaggatgtctactactcg
tccacgggccgccccgccgagctcctgctggagatgagcctcgcctcccctatgatgccg
ccgtcgcgggagacgccgcatctggtgcgcaccgcgtcgaagctgggtgacctgcgcgag
atgctgccgtccgaaaaagagcagcaaatttccgtcgatatgatgtcggagccgacggag
gcgcgccaccgcgccattactctcgggccatatccacagctggaagcgcgtgacgtgaag
cgcctgcaggcacgccgcgccggcaccacatacgtgcacgactggcccgctgtgctgaac
cttatcttacgtaaggagtggatgaagcagcgctgcgcgctggatctgtctcaagcctcc
atcccaaagaacccgctgcgcgccacggagctcttcctttgcgaggacggtgagtcgctg
tcgacgaaaaagacctttgcgcagccgtgtggcatggtggtgtggatggtcgagtacgca
ccgccgcgctacttcgatatggagttgaagacggcgccgacgcgccgcatcgtggtcgtc
gccaatgacatcacctttcagtccggatccttcgccgtcccggaggactgcgtcttcaag
gccgcctcggtgcttgcccgcgcgcagcacgtgccgtttgtgtacatcagcaccaacagc
ggcgcacgtcttggcctcagcaccgaggtcaagaagaggttcctcgtcgagttcacggag
aagaatgatatcgcctacctgtacctcaccaagagcgactacgaggagctgagggagcgg
aaggagattcggatggaagtggaaccgcttgaggtgaaaggcgagacgcggtacgtgatt
aaaggcgtggtgggtgggccgacggagtacatcggcgtcgaaaacctgagcgggtctggt
ctcgtggcgggtgagatgtcgaagaactatagcgagatcccgaccatcagcctcgtctcg
gggcgcagtgtcggcatcggcgcctacctgaaccgtcttggccgccgcgtcatccagacg
aacgactcacctctcatcctgactggctccggtgccctcaaccgactgctcggcaaggac
gtgtacatgggcaacagccagctcggcggcaagcagattatggtgccgaacggtgtcacg
cactggtgcacacaccacgactacggctctgcccgcgtgctgctgcggtggctcgactac
gtgccggctgtcctgcacccagggcgctgcacaccgcatcgcctgctttgggccgctgcc
gacccgatcgatcgcgacgtgaccttctgcccgacgtcgaatacgcagtacgacccacgc
ctcctcgtgacgggattgctcggtcagacgggcctgttcgaccgcggctcgtggatggag
acgctggaggggtgggcgcgcacggtggtggtcggccgcgccacgctcggcggcatcccg
tgtggcgtgatcctcgttgagacgcgcctgacgaagaagtttgacccggcagatccggct
gacccgacctcgacgtcttcctttattacgcaggcgggccaggtgtggtttcccgactcg
gcgcgcaagacggccgacgctctcgatgacttccaccacgagcggctgccgtgctttatc
ctggcgaactggcgcggcttctcgggcggcatgcgcgacatgtttgacgaggtgctgaag
tttggcgcctccatcgtcgacaacctccgcgtctacaccgcgccggtcttcatctacatc
ccgccagggggcgagctgcgcggcggggcctgggtggtcgtggacccgacgatcaaccac
aacggcgtcgtcgagatgtactgcgaaccgtcctcgcgcggtggcatccttgagccgtct
ggtgtggtggagatcaagttccgcgacgacgacgtgctgcagctgattcggcgcaatcgg
ccggacctcgcagcgatggaggtgaaggcggcccgtgaggccgagaaagagctgctgccg
tattaccgcgacgttgcggtgcgcttcgccgacctgcacgacacgtacgtgcggatgaaa
gcgaccggtgtggtgcgcgacgtcgtcccgtggaaggatagccgccgccacttctaccac
aagctgcaacgcaagctgaaggagctggaggtggcgaacgacatgctcgagggcggagtc
gtcggctcccttgcagggggcgtccgcaaggtcgaggagcgctactcggcggcgcacccc
aacggaccggcgtggggcacggccgaccaggatcaactgaagtggctgcggggtctcgat
ggcacgtggaccggggagagcaatggccacacggttctgaacagcagcgaatgggcgaag
gaactgcagcgcctgctcacccagaacggcggtgaggagagctcgatggagcgcgcgctg
gcgaaactcttcgagaacccggcaatcgccaaggccgcgaaggtagccttggactcgtcg
gcctgtgcgcacagcacggctgaatag

DBGET integrated database retrieval system