KEGG   Leptospira mayottensis: DPV73_05955Help
Entry
DPV73_05955       CDS       T05598                                 

Definition
(GenBank) alkaline phosphatase family protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
lmay  Leptospira mayottensis
Pathway
lmay00790  Folate biosynthesis
lmay01100  Metabolic pathways
lmay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DPV73_05955
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DPV73_05955
Enzymes [BR:lmay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DPV73_05955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AXR67622
UniProt: A0A3B6Z351
Position
I:complement(1263753..1265081)
Genome map
AA seq 442 aa AA seqDB search
MKFKIIKNKRALYYLLLVFNLQLNAETAKIVSGPILGYSTLKEVLVWIQTDQASKVALEY
SEIGNPRNKSISETIQTDYKTGFIAKLIANHVEPGKSYNYNLLVDGKRIKGEHPQIFQAQ
SFFAYASHQDPPSFSFALGSCAYVNENEFDVPGKPYGGEYSIFNSILSKKPNFMLWLGDN
IYLREPDWDSRTGFLHRYRHQRGIPELAPLFASVHHYAIWDDHDFGPNDADSSFWMRETS
EEMFKLHWGNPNYAKEGIYGSFIWGDVQFFLLDNRTFRTANNNKEIGPRQILGEKQFQWL
VNSLAYSKATFKFVAIGGQFLNPNPIFENYATYPQERNKILSAIRDLKIKNLIFLTGDRH
HTELNFLQEDGLPIYDFTVSPLTSRYHSPSEKNPLRVEGTLVDKRNFGTISVSGKRGQRK
LVLQIFDVYGKELWKKEILPTP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaattataaaaaacaaaagggctctttattatcttctattggtttttaat
cttcaactaaacgcagagaccgccaaaattgtctccgggccaattctgggatattccaca
ttaaaggaagttttagtctggattcaaactgatcaagcatccaaagttgcattagaatat
tctgaaattggaaatcctagaaataagtccatttccgaaacaatacagacggattataaa
acgggttttatcgcaaaattgatcgcaaaccacgtcgaacccggcaaaagctataattac
aatctactcgtggacggaaaaagaattaaaggagaacacccgcaaatatttcaagcgcaa
tcattttttgcctatgcgtcccatcaagaccctccttcattctcgttcgcgcttggaagt
tgcgcttatgtcaatgaaaacgaattcgacgttcctggaaaaccttatggtggtgaatac
tctatctttaactccattctttccaaaaaaccgaattttatgctctggcttggagacaac
atctatctgagagagccggattgggattcaagaaccggtttcttacaccgttataggcat
cagcgtggaattccggaacttgctccacttttcgcatctgtccatcactatgcgatttgg
gacgatcatgattttgggccgaacgacgcggattcttccttttggatgagggaaacttca
gaagaaatgttcaaactccactggggaaatccgaattatgcaaaagagggtatctacggc
tcttttatttggggagatgttcaattttttcttttggataatcgaacatttagaacggca
aataacaacaaggaaatcggcccgagacaaattctgggagaaaaacaatttcagtggctc
gtaaattccttagcatattcaaaagccacatttaagttcgtcgcgatcggcgggcaattt
ttaaatccgaatcctatttttgaaaactacgcaacatatcctcaagaaagaaataaaatt
ctttccgcgattcgagatttaaaaattaaaaatctgatttttctgacgggtgatcgtcat
cacacggagttgaactttcttcaggaagacggcttaccgatttatgattttaccgtttca
ccattaacttccagataccactccccttccgaaaaaaatcctttacgggtggaaggaacc
cttgttgataaaagaaattttggaacgatttccgtaagcgggaaacgaggtcaaagaaaa
cttgttctacagatttttgacgtatatggaaaggaactttggaaaaaagaaatccttcca
accccttag

DBGET integrated database retrieval system