KEGG   Lysobacter maris: C9I47_1059Help
Entry
C9I47_1059        CDS       T05495                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmb  Lysobacter maris
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C9I47_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PLDc_N
Motif
Other DBs
NCBI-ProteinID: AWV06776
UniProt: A0A2U9T2B1
Position
1324196..1325323
Genome map
AA seq 375 aa AA seqDB search
MLTLVLIVILAALIFEYINGFHDTANSIATVVATKVLSPMQAVGLAASMNLIGALLGTAV
AKTIASGLIDVGVVEVGSQMILCALMGGIVWNLITWWLGLPSSSSHALIGGLCGAALAAA
SNNFHAIIWSQPKEPLYKSAGVLWKVIVPMVTSPVLGFVAGFLVMGLLFFVISMMARSGG
LLARLARPRWVNSLFGKAQLVSAAGMGLAHGMNDAQKTMGIIALTLFSAQSVGTLDDLPG
WLAFLHPSDEAMATQGIDLWIKITCALVMAAGTAAGGWRIIKTLGHKLVKLHPIHGFAAE
TSASAVIFAASSLGIPVSTTHNISSAIMGVGTAKRFNAIKWTVVEKMIWAWILTIPAAGG
IAYLFFSLMRAMGWA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactggtactgatcgtcatcctcgccgcgctcatcttcgagtacatcaacggc
ttccacgacaccgccaactcgatcgccaccgtggtcgcgaccaaggtgctgtcgccgatg
caggcggtgggactggccgcgagcatgaacctgatcggcgccctgctgggcaccgcggtg
gccaagaccatcgcctccggcctgatcgacgtcggcgtggtcgaggtcggctcgcagatg
atcctgtgcgcgctgatgggcggcatcgtctggaacctgatcacctggtggctgggcctg
ccgtcctcgtcctcgcacgcgctgatcggcggtctctgcggcgccgcgctggcggcggcc
tcgaacaacttccacgcgatcatctggtcgcagcccaaggagccgctgtacaagagcgcc
ggcgtgctgtggaaggtgatcgtgccgatggtgacatcgccggtgctgggcttcgtcgcc
ggtttcctggtgatggggctgctgttcttcgtgatctcgatgatggcgcgcagcggcggc
ctgctggcgcggttggcgcggccgcgctgggtcaacagcctgttcggcaaggcgcagctg
gtcagcgccgccggcatgggcctggcgcacggcatgaacgacgcgcagaagaccatgggc
atcatcgccctgaccctgttcagtgcgcagtcggtgggcaccctcgacgacctgccgggc
tggctggccttcctgcatccgtcggacgaggcgatggccacccagggcatcgatctgtgg
atcaagatcacctgcgcgctggtgatggcggccggcaccgcggccggcggctggcggatc
atcaagaccctgggccacaagctggtcaagctgcatccgatccacggcttcgccgccgag
accagcgcatcggcggtgatcttcgccgcgtcctcgctgggcattccggtctcgaccacc
cacaacatctcgtccgcgatcatgggcgtgggcaccgccaagcgcttcaacgcgatcaag
tggaccgtggtcgaaaagatgatctgggcgtggatcctgacgattcccgccgccggcggc
atcgcctatctgttcttcagcctgatgcgggcgatgggctgggcttga

DBGET integrated database retrieval system