KEGG   Lysobacter maris: C9I47_2330Help
Entry
C9I47_2330        CDS       T05495                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lmb  Lysobacter maris
Pathway
lmb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C9I47_2330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmb03011]
    C9I47_2330
Ribosome [BR:lmb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C9I47_2330
  Bacteria
    C9I47_2330
  Archaea
    C9I47_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AWV08013
UniProt: A0A2U9T652
Position
complement(2870381..2870722)
Genome map
AA seq 113 aa AA seqDB search
MTMEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAGMIRKVVESAIANA
ENNQGADIDELKVKTIMVDEGPTLKRFMARAKGRGTRILKRTSHITVVVGAGK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaagcgaaagccatcctgcgcaccgcgcgcatctccccgcagaaggctcgt
ctggtcgccgaccaggtgcgtggcctgtcggccgagcgcgctgtcaacctgctgaagttc
tccgacaagaaggccgcgggcatgatccgcaaggtcgtcgagtcggctatcgccaacgcg
gagaacaaccagggcgccgacatcgacgagctcaaggtcaagaccatcatggtggacgag
ggtccgacgctgaagcgcttcatggcgcgggcgaagggccgcggcacccgcatcctcaag
cgcaccagccacatcactgtggttgtgggcgccggcaagtaa

DBGET integrated database retrieval system