KEGG   Lysobacter maris: C9I47_2450Help
Entry
C9I47_2450        CDS       T05495                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
lmb  Lysobacter maris
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C9I47_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AWV08128
UniProt: A0A2U9TC48
Position
2997574..2997957
Genome map
AA seq 127 aa AA seqDB search
MNRPAEYALDIEVATRYLDDQSEPEQDRYVFAYTIHIRNRGTVPARLLARHWVITDANGK
VQEVEGDGVVGEQPWLRPGEDFEYTSGAMLETDLGTMQGHYRMLADDGTQFDAPIPPFTL
TVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccccgccgaatacgccctcgacatcgaagtcgcgacccgctatctggacgac
cagtccgagcccgaacaggatcgctacgtcttcgcctacaccatccacatccgcaatcgc
ggcacggtgcccgcgcgcctgcttgcccggcactgggtcatcaccgatgccaacggcaag
gtccaggaggtcgagggcgacggcgtggtcggcgagcagccctggctgcgtcccggcgag
gacttcgaatacacctccggcgcgatgctggaaaccgatctgggcacgatgcagggccac
taccgcatgctcgccgacgacggcacccagttcgacgcgccgattccgccctttaccctg
accgtgccgcgcacgctgcactga

DBGET integrated database retrieval system