KEGG   Lysobacter maris: C9I47_2489Help
Entry
C9I47_2489        CDS       T05495                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
lmb  Lysobacter maris
Pathway
lmb00270  Cysteine and methionine metabolism
lmb00480  Glutathione metabolism
lmb01100  Metabolic pathways
Module
lmb_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C9I47_2489
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C9I47_2489
Enzymes [BR:lmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     C9I47_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AWV08167
UniProt: A0A2U9TAF4
Position
3042883..3043845
Genome map
AA seq 320 aa AA seqDB search
MPLDIVVVMDPIGSIKIAKDSTFAMLLEAQRRGHRLLYVPPGGLSMRDGRPIAQVAGLSV
REDATSWFELEQASHIELGHGQVVLMRKDPPVDAEYIHDTQILGIAQLAGALIVNDPQGL
RDYNEKLAALLFPECCPATVVTRDNAILKAFVAEHGEAVLKPLDGMGGRSIFRARAGEPN
LNVILETLTEGGRRLAMAQRYLPEIADGDKRILLIDGEPVDYCLARIPQGDEFRGNLAAG
GRGEARPLSERDRWIAARVGPEMKRRGMLFVGLDVIGDYLTEVNVTSPTCIREIDAAFGT
NIAGQLFDAIEARAAAQASA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgacatcgtcgtcgtgatggaccccatcggctccatcaagatcgccaaggac
tctaccttcgccatgttgctggaagcgcagcggcgcggacatcgcctgctgtacgtaccg
ccgggaggactgtcgatgcgggacggccggccgatcgcgcaggtggccggactgagcgtg
cgcgaggacgcgacgagctggttcgaactggaacaggcatcacatattgagctcggccac
ggccaggtcgtgctgatgcgcaaggacccgccggtcgacgccgagtacatccacgacacc
cagatcctcggcatcgcccagctggccggcgcgctgatcgtcaacgacccccagggcctg
cgcgactacaacgagaagctggccgcgctgctgttccccgaatgctgcccggcgaccgtg
gtcacccgcgacaacgcgatcctgaaggccttcgtcgccgagcatggcgaggcggtgctc
aagcctctggatggcatgggcgggcgctcgatcttccgcgcccgcgccggcgagcccaac
ctcaacgtgatcctggagaccctgaccgagggaggcaggcggctggcgatggcccagcgc
tacctgccggagatcgccgacggcgacaagcgcatcctgctgatcgacggcgagccggtc
gactactgtctggcccggatcccgcagggcgacgagttccgcggcaatctcgccgccggt
ggtcgcggcgaggcccgcccgttgagcgaacgcgaccgctggatcgccgcccgggtcggc
ccggagatgaagcgccgcggcatgctgttcgtcggcctggacgtgatcggcgactacctg
accgaggtcaacgtcaccagtccgacctgcatccgcgagatcgacgccgccttcggcacc
aacatcgccggccagctgttcgacgcgatcgaagccagggccgccgcgcaagcctccgcc
tag

DBGET integrated database retrieval system