KEGG   Lysobacter maris: C9I47_2535Help
Entry
C9I47_2535        CDS       T05495                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
lmb  Lysobacter maris
Pathway
lmb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C9I47_2535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmb01007]
    C9I47_2535
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmb03016]
    C9I47_2535
   03029 Mitochondrial biogenesis [BR:lmb03029]
    C9I47_2535
Enzymes [BR:lmb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     C9I47_2535
Amino acid related enzymes [BR:lmb01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   C9I47_2535
Transfer RNA biogenesis [BR:lmb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C9I47_2535
 Prokaryotic Type
   Other AARSs
    C9I47_2535
Mitochondrial biogenesis [BR:lmb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C9I47_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AWV08212
UniProt: A0A2U9T9F4
Position
complement(3110151..3111917)
Genome map
AA seq 588 aa AA seqDB search
MRTHYCGLIDEALIGQTVTLCGWADVARDLGGLCFIDLRDHEGIVQVVAEPEQGVDGNAE
VIATAAKVGYEDCLRITGEVRRRESPNAKIATGQVEVVARRIEVLNKAEPLPFHAHENPG
EDIRLQYRYLDLRTPEMQRKMRTRTKLVQALRRWLDGRGFQDIETPILTKATPEGARDFL
VPARMHPGEFYALPQSPQLFKQILMVAGFDRYYQIARCFRDEALRADRQLEFTQLDMEFA
WVSERDVQDATETMIRDVFREVVEVELGQFPRMTWAEAMRRYGSDKPDLRIALELVDVDV
QVKDSQFKVFTDWAGVDGGRVCALRIPGGASLSRKQIDEYAAHAAKYGARGLAYIKLSDS
GEVSSPIAKFFDEAQFSALLAEVGAGNGDIVFFGAGQYGTVSDFMGALRLKAGRDFGLVE
AGWRPLWVTDFPMFEWDAEAGRHVALHHPFTAPAVDDVEDLRANAKTAVSRGYDMVLNGN
EIGGGSIRIHRPAMQSAVFELLGIGKEEAEAKFGFLLDALRYGAPPHGGIAFGIDRIAAL
MAGTESIRDVIAFPKTTTAQCLMTGAPSPIADAQLAEVHVAVRPKAEG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccattactgcggcctcatcgacgaggccctgatcggccagaccgtcaccctg
tgcggctgggccgacgtcgcccgcgatctcggcggcctgtgcttcatcgatctgcgcgac
cacgaaggcatcgtccaggtcgtcgccgagccggaacagggcgtcgacggcaatgccgag
gtgatcgcgaccgcggcgaaggtcggctacgaggactgcctgcggatcaccggcgaggtg
cgccgtcgcgagtcgccgaacgcgaagatcgcgaccggccaggtcgaggtcgtcgcccgc
cgcatcgaagtgctgaacaaggccgagccgctgccgttccacgcccacgagaacccgggc
gaggacatccgcctgcagtaccgctatctggacctgcgcacccccgagatgcagcgcaag
atgcgcacccgcacgaagctggtgcaggcgctgcgccgctggctggacgggcgcggcttc
caggacatcgagactccgatcctgaccaaggccacgccggagggcgcgcgcgacttcctg
gtgccggcgcggatgcatccgggcgagttctacgcgctgccgcagtcgccgcagctgttc
aagcagatcctgatggtggccggcttcgaccgctactaccagatcgcgcgctgcttccgc
gacgaggccctgcgcgccgaccgccagctggagttcacccagctcgacatggagttcgcc
tgggtgtccgagcgcgacgtccaggacgccaccgaaaccatgatccgcgacgtgttccgc
gaggtcgtcgaggtcgagctgggccagttcccgcgcatgacctgggccgaggcgatgcgt
cgctacggttccgacaagccggacctgcgcatcgccctggagctggtcgatgtcgacgtc
caggtgaaggactcgcagttcaaggtgttcaccgactgggccggggtcgacggcggccgc
gtctgcgcgctgcgcatccccggcggcgcttcgctcagccgcaagcagatcgacgagtac
gccgcgcacgcggccaagtacggcgcgcgcgggctggcctacatcaagctgtcggacagc
ggcgaggtgtcctcgccgatcgccaagttcttcgacgaggcgcagttctccgccctgctg
gccgaggtcggcgccggcaacggcgacatcgtgttcttcggcgccggccagtacggcacg
gtcagcgacttcatgggcgcgctgcggctcaaggccggtcgtgacttcggcctggtcgag
gccggctggcgcccgctgtgggtcaccgacttcccgatgttcgaatgggacgccgaggcc
gggcgccacgtcgccctgcaccatccgttcaccgcgccggcggtggacgatgtcgaggac
ctgcgcgcgaacgccaagaccgcggtcagccgcggctacgacatggtcctcaacggcaac
gagatcggcggcggctcgatccgtatccaccgcccggcgatgcagtcggcggtgttcgag
ctgctgggcatcggcaaggaggaggcggaggccaagttcggtttcctgctcgatgcgctg
cgctacggtgcgccgccgcacggcggcatcgccttcggcatcgatcgcatcgccgcgctg
atggccggcaccgagtcgatccgcgacgtgatcgcattccccaagaccaccaccgcgcaa
tgcctgatgaccggcgcgccgtcgccgatcgcggacgcgcagctggccgaggtgcacgtc
gcggtgaggccgaaggcggaaggctga

DBGET integrated database retrieval system