KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_00174Help
Entry
Lm4b_00174        CDS       T00898                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00450  Selenocompound metabolism
lmc00970  Aminoacyl-tRNA biosynthesis
lmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Lm4b_00174 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Lm4b_00174 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmc01007]
    Lm4b_00174 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmc03016]
    Lm4b_00174 (metS)
Enzymes [BR:lmc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Lm4b_00174 (metS)
Amino acid related enzymes [BR:lmc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Lm4b_00174 (metS)
Transfer RNA biogenesis [BR:lmc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Lm4b_00174 (metS)
 Prokaryotic type
   Other AARSs
    Lm4b_00174 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: CAS03965
Position
172466..174460
Genome map
AA seq 664 aa AA seqDB search
MPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQ
AKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDI
YLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYA
DRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWI
DALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFG
HGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNF
DLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQFS
VALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRT
PGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAEVEVTYIQDEMKGS
APAPAKEAAEVEALETPQIGIEDFDKIDLRVAEVKQVDKVKKADKLLCFQLDLGEGKLRQ
VLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMSEGMILSGEKDGKLSVIEASSALPNG
AKVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaagagaaaaatacgttttatattaccacaccaatctattatccaagcggaaaa
gcgcatatcggccatgcttatacgactgttgcgggggacgcgatggctcgttataaacgc
ttaaaaggatatgatgtgttttacttaactggaacagatgagcacggtcaaaaaatccaa
gcaaaagcgaaagaacgcggaatttctgaacaagaatacgtggatgaaatcgcagaaggt
ttccaagaactttggaaaaaactagaaatttctaatacggattttattcgtacaacacaa
gaccgtcataaaacatcggttgaaaaaatctttgaacaacttttagaacaaggcgacatt
tacttaggtgaatacgaaggttggtactctgtttctgatgaagaatactttacagaaaca
cagttagaagaagtatataaagatgaaaatggtaaagtaatcggcggaaaagccccaagt
ggcaatgaagtcgaactagtgaaagaagaatcctacttcttccgtatgagcaaatatgcg
gaccgtttagtagaatattataattcccatccagaatttatccttcctgaatctagaaaa
aatgaaatgattaataatttcatcaaacctggtttggaagatttagctgtatctagaaca
acttttgattggggtattaaagttcctggcaatccaaaacacgttgtttatgtatggatt
gacgcgctttctaactatattactgcgcttgggtataatacggacaatgacacgaaattc
caaaaatactggcctgctgatgtacaaatcgttgggaaagaaatcgttcgtttccacacg
atttattggccaattatgctgatggcactagacttaccacttccaaaaatggtgttcggc
cacggctggattctaatgaaagatggtaaaatgtctaaatccaaagggaatgtagtagat
ccttatatgctgattgaccgctacggcctagatgcgcttcgttattacttattacgcgaa
gttccatttggttcagatggtttatttacaccggaagactttgttgatcgtgtgaacttt
gatcttgccaacgatttaggaaacttacttaatcgtacagtagcaatgattaataagtac
tttgatggcgaaattccggcttatcaaggcaatgtaacagaattcgatcaaaccttagtg
gatttcaaaaacaatgtggtgaaggaatatgaaggtagcatggatcacatgcaattctct
gtagctttaaaccaactgtggtcactaatttctcgtacaaataaatatatcgatgaaacc
gctccatggacacttgccaaagacgaagataaacgcacagaacttgcgagcgtaatgact
catttagcagaaaacttacgtattatcgcagtacttttgcaaccattcttaacaagaact
ccaggcgaaatcttcttacaactaggtttacaagaagaaaacttgaaaaaatgggatagc
atctatggatacggtgaaattccagctggcacaacagtggtgaaaaaaggtacgccaatt
ttcccaagacttgaggcagaagtagaagttacttatatccaagatgaaatgaaaggctct
gcgccagctcctgccaaagaagcggcggaagttgaagcgcttgaaacaccgcaaatcggc
attgaagatttcgataaaatcgatcttcgtgttgcagaagtaaaacaagtagataaagtg
aaaaaagcagataaacttctttgtttccaattagacttaggggaaggaaaactgcgccaa
gtgctttcaggcattgcagaattctatcaaccagaagaactaatcggcaaaaaagttatc
gtcgtttctaacttaaaacctgtaaaacttcgcggactaatgagtgaaggaatgatactc
tcaggcgaaaaagatggtaagctaagtgtaatcgaagcaagtagcgcacttccaaatggt
gcaaaagtaaaatag

DBGET integrated database retrieval system