KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_00846Help
Entry
Lm4b_00846        CDS       T00898                                 

Gene name
fbp
Definition
(GenBank) Putative fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00010  Glycolysis / Gluconeogenesis
lmc00030  Pentose phosphate pathway
lmc00051  Fructose and mannose metabolism
lmc00680  Methane metabolism
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01120  Microbial metabolism in diverse environments
lmc01130  Biosynthesis of antibiotics
lmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lm4b_00846 (fbp)
   00030 Pentose phosphate pathway
    Lm4b_00846 (fbp)
   00051 Fructose and mannose metabolism
    Lm4b_00846 (fbp)
  Energy metabolism
   00680 Methane metabolism
    Lm4b_00846 (fbp)
Enzymes [BR:lmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Lm4b_00846 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CAS04614
UniProt: C1L199
Position
complement(860113..862074)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLLASETEDLQAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIINRRKEFDMDHRLLLQFIDYKKGTIHLKGKEYLLLDSHFP
TINPEKPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HEDGTFMEMKLRGEKYAGRSLLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFGLDGECGHIINGHTPV
KEGKGESPIKANGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactattgcc
aagacagctacggaaatcattaatctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcggagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgcttgctagt
gaaacagaagatttgcaggcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtacgttgcttcaaaatacacacgttctaaagtgagaaaagccatgcccgaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgacaaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagtgct
ctctcgttacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtctat
gatcgtggtccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggttctagggtttgt
gcggctaatgttattcggatttctgcccgttatttaaatttagatattttagaagatagt
tacggtatttctcttcgccccctggccctttttgccgacgaagtgtacaaagacgatcct
tgtacctacttccagcccaaaaacgaagaaaatattaactatagtaatgcagaaatcacg
caaattgctaggatgcataaggctatctcgattattcagtttaaattggaaggtgaaatt
ataaatcgacgcaaagaatttgatatggatcaccgacttttacttcaatttatcgattat
aaaaaaggcacaattcatctaaagggaaaagaatacctgttgttagacagtcattttcca
acgattaatccagaaaaaccttatgaactcactgacgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgtcgtcgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggtaatttactctaccatggctgcattccactc
cacgaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgttcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtacgtccaactggaactaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
tttggaaaaagtgaaatgactacatttgaacgttattttgttgcagaaaaagaaacacac
acagaagaaaaaaatccttactacaaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgggcttgatggtgaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgaatggtaaaatgctcgtcatcgatggc
gggttcgcaaaggcctatcataaagaaacgaacttagcgggttatacactactttttaat
agttacggtttacaattagtgagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttattgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgagcaggcagaagatttaaaattgtta
ctagatgcctatcgtaatggcttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system