KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_01054Help
Entry
Lm4b_01054        CDS       T00898                                 

Definition
(GenBank) Putative glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00561  Glycerolipid metabolism
lmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lm4b_01054
Enzymes [BR:lmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Lm4b_01054
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lm4b_01054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C DUF4248
Motif
Other DBs
NCBI-ProteinID: CAS04820
Position
1064099..1065562
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKAGELVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIV
DILAKHDLIPADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKELCETLKKAGYE
KRIKQLTGLKIDSYFSASKMKWLLENSSAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDAFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGSPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMTGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPAEELSAIGAIEIADNKLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatcgctattgatcaaagcacatctggaacgaaagtattattg
tttaaagcaggtgaacttgtagatcgtttagataaaaagcatcgacagttgtatccgaag
aaaggctgggtagagcataatccaatcgaaatttgtcaaaatgtccgtacattaattgtg
gacatattggcaaaacatgatttaattccagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacgggcaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaactttgcgaaacattaaaaaaagctggttatgaa
aaaagaattaaacagcttaccggattgaaaattgattcttatttttctgcttctaaaatg
aagtggttattggaaaatagttctgcggtgcgggatgcagcaagtcgtaatcaattggca
tttggtacaatggatgcttggttgttattttcgcttacggatgatagtaattatttcaca
gaccgaacaaacgccagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaactttttggagttaaacgtgcttatttaccagaagtgaagcaatctgct
ggaagttttggaagttatcaggagataccgattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatgcatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaaggaattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggttcgccttattggaatacagatatacgagcagagattcttggtctcaca
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgacaggtcaaaatattaagcgcttacaagta
gacggtggattaacaaagcaacatgagttgatgcaatatttagcagatgttttaaaagca
gaagtggcagtcagtcccgcggaagaactttcggcaattggtgctattgaaattgccgac
aataaactacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system