KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_01423Help
Entry
Lm4b_01423        CDS       T00898                                 

Definition
(GenBank) Putative Acetyl-CoA:acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00071  Fatty acid degradation
lmc00072  Synthesis and degradation of ketone bodies
lmc00280  Valine, leucine and isoleucine degradation
lmc00310  Lysine degradation
lmc00362  Benzoate degradation
lmc00380  Tryptophan metabolism
lmc00620  Pyruvate metabolism
lmc00630  Glyoxylate and dicarboxylate metabolism
lmc00640  Propanoate metabolism
lmc00650  Butanoate metabolism
lmc00900  Terpenoid backbone biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01120  Microbial metabolism in diverse environments
lmc01130  Biosynthesis of antibiotics
lmc01200  Carbon metabolism
lmc01212  Fatty acid metabolism
lmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lm4b_01423
   00630 Glyoxylate and dicarboxylate metabolism
    Lm4b_01423
   00640 Propanoate metabolism
    Lm4b_01423
   00650 Butanoate metabolism
    Lm4b_01423
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lm4b_01423
   00072 Synthesis and degradation of ketone bodies
    Lm4b_01423
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lm4b_01423
   00310 Lysine degradation
    Lm4b_01423
   00380 Tryptophan metabolism
    Lm4b_01423
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lm4b_01423
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lm4b_01423
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Lm4b_01423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmc04147]
    Lm4b_01423
Enzymes [BR:lmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Lm4b_01423
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lm4b_01423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAS05186
Position
complement(1427568..1428737)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system