KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_01565Help
Entry
Lm4b_01565        CDS       T00898                                 

Gene name
hemB
Definition
(GenBank) Putative delta-aminolevulinic acid dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00860  Porphyrin and chlorophyll metabolism
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lm4b_01565 (hemB)
Enzymes [BR:lmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Lm4b_01565 (hemB)
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lm4b_01565 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Metallophos_3
Motif
Other DBs
NCBI-ProteinID: CAS05326
Position
complement(1574176..1575150)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVASMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAMSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVLEMLT
SMKRAGATLIITYFAKDASKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagcttctatgcctggggtttttcaatatcctttacatgaa
ctagaagaagaaatgcgcgtagttgagagccttggtattaaagcggttattttatttggt
attcctgccgagaaagacgcagttggcacgcaagcttatcacgaccacggaattattcaa
gaagctacaaggcttataaaaaaaagttttcctgaaattcttgtggtggctgacacatgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggggaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgctgcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagcgggattttatgatatcccaattatgtcatatgcagttaaatatgcgtctgctttt
tatggaccgttccgtgatgctgctggtagtgcccctcaatttggtgatagaaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaatgtcggatgaacaagaa
ggtgcagatttccttattgttaaaccatcattatcatacttagatatcatgcgcgatgtt
aagaacaataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagatgaagaaaaaattgttttagaaatgctaaca
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgcatccaaa
tatttaaataaatag

DBGET integrated database retrieval system