KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_01639Help
Entry
Lm4b_01639        CDS       T00898                                 

Gene name
trpB
Definition
(GenBank) Putative tryptophan synthase (beta subunit)
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00260  Glycine, serine and threonine metabolism
lmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01130  Biosynthesis of antibiotics
lmc01230  Biosynthesis of amino acids
Module
lmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lm4b_01639 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lm4b_01639 (trpB)
Enzymes [BR:lmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lm4b_01639 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAS05400
UniProt: C1KVS5
Position
complement(1654513..1655715)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQIND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgggcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggtaaacaaaaagtagtggcagaaactggcgcaggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtgtttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagacacgcattacattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgtgataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgttgcttgtgttggaggcgggagtaat
gcgatggggttattttatccatttgtagatgatgtttctgttcaaatgcacggtgtggaa
gcagcgggacacggtttagaaactgaattccatgcagcgactatttccaaaggagaaata
gggattttacacggagcgatgatggacgttttacaagatgagaatggacaaattttggaa
gcattttcgatttcagctggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtaccattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacggaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccaaatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaatcaactaaaggaacgcttggagggacaaataaatgac
taa

DBGET integrated database retrieval system