KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_02276Help
Entry
Lm4b_02276        CDS       T00898                                 

Definition
(GenBank) Putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Brite
KEGG Orthology (KO) [BR:lmc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Lm4b_02276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAS06033
Position
2344364..2345362
Genome map
AA seq 332 aa AA seqDB search
MEGMFLITLVIVLAALAFDLINGFHDTANAIATSVSTKALKPRHAIILAAVMNFVGAISF
TGVAKTITKDIVNPFDLDHGELVILAALLSAIAWNLITWYFGIPSSSSHALIGSIAGAAI
ASAGFAAIEYSGFTKIIVGLLVSPVLAFVVGYTIYSLFKVFLKNLNLATTNRRFRMIQVG
TAALQSYTHGTNDAQKSMGIITMALIASGFQTTDDVQLWVQVSCAIAMAIGTSIGGWKII
KTVGGKIMKIKPVNGVAADLSSVIIIFGATFIHLPVSTTHVISSSILGVGTAHRVKGVKW
DTAQRMIITWVITLPISATIAALIFYVLRFIL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatgtttctcatcaccctcgtcatcgtacttgccgcgctagcatttgacctg
atcaacgggtttcatgatacagctaacgcaattgcgactagtgtctctacaaaagcctta
aaaccacgacatgcgattattcttgctgccgtaatgaactttgtgggtgctatttcattc
acaggggttgctaaaacaattacaaaagacattgttaacccattcgacttagatcacggc
gaacttgttattttagcagcattactttcagctattgcttggaacttaatcacttggtat
ttcggaattcctagtagttcctcccatgccttgattggatccatcgccggtgcagccatt
gcatcagccggatttgcagcaattgaatacagcggatttactaaaatcattgttggttta
ttagtatctcctgtacttgctttcgtagtcggttacacgatatattcactcttcaaggtt
ttcctgaagaacttaaacttagccacgaccaatcggcgcttccggatgattcaagtcgga
actgctgcgctacaatcttacacacacggaactaatgatgcacaaaaatcaatggggatt
atcacaatggcattaattgctagtggtttccaaacaaccgatgatgtgcaattatgggtt
caagtatcctgtgcgattgccatggcgattggtacgagtattggtggttggaaaatcatc
aaaactgttggcggtaaaatcatgaaaatcaaaccagttaatggtgtagcggctgattta
agttccgttatcattattttcggtgctactttcattcatttaccagttagtacaacacac
gtaatcagctcttctatccttggtgttggaacagctcaccgtgtcaaaggtgtcaaatgg
gatactgcccaacgtatgattattacttgggttatcacacttcctatttcagcaacaatt
gcagcacttatcttctatgtactaagatttattctttaa

DBGET integrated database retrieval system