KEGG   Listeria monocytogenes CLIP 80459 (serotype 4b): Lm4b_02578Help
Entry
Lm4b_02578        CDS       T00898                                 

Gene name
adk
Definition
(GenBank) Putative adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
lmc  Listeria monocytogenes CLIP 80459 (serotype 4b)
Pathway
lmc00230  Purine metabolism
lmc00730  Thiamine metabolism
lmc01100  Metabolic pathways
lmc01110  Biosynthesis of secondary metabolites
lmc01130  Biosynthesis of antibiotics
Module
lmc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lmc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Lm4b_02578 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Lm4b_02578 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmc04147]
    Lm4b_02578 (adk)
Enzymes [BR:lmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Lm4b_02578 (adk)
Exosome [BR:lmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lm4b_02578 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 AAA_18 Thymidylate_kin Cytidylate_kin Prim_Zn_Ribbon DUF5024
Motif
Other DBs
NCBI-ProteinID: CAS06332
UniProt: C1KZF9
Position
complement(2661276..2661923)
Genome map
AA seq 215 aa AA seqDB search
MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP
DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAEELENILNDLGTELDAVINIEVDKDVL
MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK
PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILASF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagtattaatgggactgcccggcgccggaaaaggcacacaagcggaacagatt
gttgagaaatacaacattcctcatatttccactggagatatgttccgagcagctatgaaa
aataatacggaattaggaaagaaagctaaatcctttatggataatggcgaccttgttcct
gatgaagtaacaaatggtatcgttcgtgaacgtttggccgaagatgatgctaagaatggt
ttcttgcttgatggttttccgcgcactgtggaacaagcagaagagctagaaaatattcta
aatgatttagggacagaacttgatgctgtcattaacattgaagttgataaagatgtttta
atgaaacgtcttacaggtcgttggatttgtcggacttgcggtaagacttaccatgaaatt
tacaacccaccgaaagttcctgggaaatgtgatttagatggcggagaactttaccaacgc
gatgacgacaagaaagaaacggttgaaaaacgactaaatgtaaatatgaaacagaccaag
ccgcttctagatttttattctgaaaagggtaaacttcataacataaacggcgagcaagac
attaaagacgtttttgtagatgtggaaaaaattcttgcttctttttga

DBGET integrated database retrieval system