KEGG   Leisingera methylohalidivorans: METH_12390Help
Entry
METH_12390        CDS       T02961                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00620  Pyruvate metabolism
lmd00630  Glyoxylate and dicarboxylate metabolism
lmd01100  Metabolic pathways
lmd01110  Biosynthesis of secondary metabolites
lmd01120  Microbial metabolism in diverse environments
lmd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    METH_12390
   00630 Glyoxylate and dicarboxylate metabolism
    METH_12390
Enzymes [BR:lmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     METH_12390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AHD01369
UniProt: V9VUK2
Position
complement(2374027..2376174)
Genome map
AA seq 715 aa AA seqDB search
MSRVEKQGIQVAPELADFIEKQALPGTGVEAEAFWAGLAELVNGLGPENRALLDKREKMQ
AEIDAWHIANRDKPHDHEGYKAFLTGIGYLLPEGGDFEIETRNVDPEIASVPGPQLVVPI
TNARYALNAANARWGSLYDGFYGTDAMGSPAPKGGYDKGRGARVVARARVFLDEAFPIDG
ASHADVRRYYVQDGQLLVDDLPLAQPEKFAGYRGNPKAPEAVLLRNNGLHVELVFDRAHA
IGARDQAGLADVRLESAMSAIMDCEDSVACVDAEDKVQAYSNWLGLMKGDLEAKLDKGGK
SITRRLNPDFGFTAPDGSAMSVKGRAVLWVRNVGHLMTNPAVLDQDGKEAYEGLLDALIT
VLIAKHDLKREGGNSAHGSVYVVKPKMHGPEEVAFTDRIFGKVEDILGLPRHTVKIGIMD
EERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIKRKGWIGAYE
NLNVDIGLECGLSGKAQIGKGMWAMPDMMAAMLEQKIEHPKSGANCAWVPSPTAATLHAL
HYHKVDVFAVQKRLKAGGRRAHVDGILEIPLATYRKWTPQQIAREVDNNAQGILGYVVRW
IDQGVGCSKVPDINDVGLMEDRATCRISAQHIANWLHHGVVSEEEVMGSLRKMAKVVDEQ
NRGDNTYRSMAPGYDSIAFQAACDLVLKGRVQPSGYTEPVLHARRLELKAQEATS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggtcgaaaagcagggaattcaggttgcgccggaattggcggattttatcgaa
aagcaggcactgcccggtaccggggttgaggcagaagcgttctgggcgggcctggcggag
ctggtgaacgggctcggcccggaaaaccgcgcgctgctggacaaacgggaaaagatgcag
gcggaaatcgatgcctggcatatcgccaaccgggataagccgcatgatcacgagggctat
aaggcttttctgaccggcattggctatctgctgcccgagggcggggattttgagatcgag
acgcggaatgtggatcccgagatcgcctcggtgccggggccgcagctggtggtgccgatc
accaatgcccgctatgcgctgaatgcggcgaatgcccgctggggcagcctgtatgacggg
ttttatggcaccgatgcgatgggcagcccggcgcccaagggcggttatgacaagggccgc
ggcgcgcgggttgtggcacgggcgcgggtgttcctggatgaagcctttccaattgacggc
gccagccacgcggatgtgcgccgctactatgtgcaggacgggcagctgctggtcgacgat
ctgccgctggcgcaaccggagaaattcgcaggctaccgcggcaaccccaaggcgccggag
gcggttcttttgcgtaacaatggcttgcatgtggagctggtgtttgaccgcgcccatgcg
atcggggcgcgcgatcaggcggggctggcggacgtgcggctggaaagcgccatgtctgca
atcatggattgcgaggactcggtggcttgcgttgatgccgaggataaagtgcaggcctat
tccaattggctggggctgatgaagggcgatctggaagcgaagctggacaagggcggcaag
agcattacccgccgtctgaacccggatttcggcttcactgcgccggacggctctgcgatg
tccgtgaagggccgggcggtgctgtgggtgcgtaatgtgggccatctgatgaccaacccg
gcggtgctggatcaggacgggaaggaagcctatgaagggctgctggacgcgctgatcacc
gtcctgatcgccaagcacgacttgaagcgcgagggcggcaactcggcccacggttctgtc
tacgtggtgaagcccaagatgcatgggccggaggaagtcgcctttaccgaccggatcttc
ggcaaggtcgaggatatcctgggcctgccgcgccacaccgtgaagatcggcatcatggat
gaggagcgccgcacctcggtcaacctcaaggaatgcatccgcgcggccaagcaccgggtg
gccttcatcaataccggtttcctggaccgcaccggggacgagatccacacctcgatggag
gcggggccgttctcccgcaaggacttcatcaagcgcaagggctggatcggcgcctatgag
aacctgaacgtggatatcgggctggaatgcggcctgagcggcaaggcacagatcggcaag
ggcatgtgggcgatgccggacatgatggcggcgatgctggagcagaagatcgaacatccg
aaatccggcgccaattgcgcctgggtgccaagcccgaccgccgcgaccctgcatgcgctg
cattaccacaaggtggatgtgtttgcggtgcagaaacggctcaaagcaggcggccgccgc
gcccatgtggacggtattctggaaattccgctggccacctaccgcaaatggacgccgcag
cagattgcacgcgaggtggacaacaacgcgcagggcatcctcggctatgtggtgcgctgg
atcgaccagggggtggggtgctccaaggtgccggacatcaatgacgtcggcctgatggaa
gaccgcgccacttgccggatctccgcccagcacattgccaactggctgcaccacggcgtg
gtcagcgaagaggaggtgatgggctccctgcgcaagatggccaaggttgtggacgagcag
aaccgcggcgacaatacctaccgttcgatggcgccgggctatgacagcatcgccttccag
gcggcctgcgatctggtgttgaagggccgggtgcagccatcgggctataccgagccggtg
ctgcacgcccggcggctggagttgaaggcgcaagaagccacgagctga

DBGET integrated database retrieval system