KEGG   Leisingera methylohalidivorans: METH_13850Help
Entry
METH_13850        CDS       T02961                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00670  One carbon pool by folate
lmd01100  Metabolic pathways
lmd01120  Microbial metabolism in diverse environments
lmd01200  Carbon metabolism
Module
lmd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    METH_13850
Enzymes [BR:lmd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     METH_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Nas2_N
Motif
Other DBs
NCBI-ProteinID: AHD01632
UniProt: V9VXM8
Position
complement(2668980..2670656)
Genome map
AA seq 558 aa AA seqDB search
MSYKSDIEIAREAQKKPIQEIGAKIGISDSDLLPYGHDKAKVSQSFINSVQDREDGKLIL
VTAINPTPAGEGKTTTTVGLGDGLNRIGKNAMICIREASLGPNFGMKGGAAGGGYAQVVP
MEEMNLHFTGDFHAITSAHSLLSAMIDNHIYWGNECDIDTRRVAWRRVVDMNDRALRVIT
ASLGGVSNGFPREAGFDITVASEVMAILCLANDLKDLEKRLGDIIVAYRRDKTPVYCRDI
KAEGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATKTALKVADYVVTE
AGFGADLGAEKFMNIKCRKAGIAPSAVVLVATVRAMKMNGGVAKADLGDENVDAVNAGCA
NLGRHIENIKSFGVPVVVAINHFVTDTDAEVEAVKAYAATHGVEAVLSRHWELGSEGSAP
LAEKVVEIVDAGQANFAPIYPDEMSLFDKIDTIAKRIYRADEVLADNKIRNQLKEWEEAG
YGNLPVCMAKTQYSFSTDPSLRGAPVGHSVPVREVRLSAGAGFIVAVCGEIMTMPGLPRK
PASETIRLNDDGQIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaagagtgacatcgagattgcgcgtgaagcgcagaagaaaccgatccaggag
attggtgcgaagatcgggatttcggacagcgatctgctgccctacggccacgacaaggca
aaggtgtcccagtccttcatcaactcggtgcaggaccgcgaagacggcaagctgatcctg
gtgaccgcgatcaacccgaccccggcgggcgaaggcaagaccaccaccaccgtgggcctg
ggcgacggtctgaaccggatcggcaagaacgcgatgatctgcatccgcgaagcctccctc
ggcccgaacttcggcatgaagggcggcgctgcaggcggcggctatgcgcaagtggtgccg
atggaggagatgaacctccacttcaccggcgacttccacgccatcacctcggcgcattcg
ctgctgtcggcgatgatcgacaaccacatctactggggcaatgagtgcgacatcgacacc
cgccgcgtcgcctggcgccgggttgtggacatgaacgaccgcgccctgcgggtgatcacc
gcgtccctgggcggcgtctccaacggcttcccgcgcgaagccggctttgacatcaccgtg
gcctcggaagtgatggcgattctgtgcctcgccaacgatctgaaagacctggaaaagcgc
ctcggcgacatcatcgtggcctaccgtcgcgacaagaccccggtctactgccgcgacatc
aaggccgaaggcgcgatgaccgtgctgctgaaagacgcaatgcagccgaacctggtgcag
accctggaaaacaacccggcgtttgtgcacggcggcccgttcgccaacatcgcccacggc
tgcaactcggtgatcgccaccaagaccgccctgaaagtcgccgactacgtggtgaccgag
gccggtttcggcgccgatctgggtgctgagaagttcatgaacatcaaatgccgcaaggca
ggcatcgccccctccgcggtggtgctggtggccaccgtgcgggcgatgaagatgaacggc
ggcgttgccaaggcggacctgggcgacgagaacgtcgacgcggtcaacgcgggctgcgcc
aacctcggccgccacatcgagaacatcaaatccttcggtgttcctgttgtggttgcgatc
aaccacttcgtcaccgacaccgatgccgaagtggaggctgtcaaagcctatgccgccacc
catggcgtcgaggcggtgctgtcgcgccactgggaactgggttcggaaggctcggcgccg
ctggccgagaaggttgtggaaatcgtcgatgcgggccaggccaactttgcgccgatctac
cccgacgagatgtccctgttcgacaagatcgacaccatcgccaagcgcatctaccgcgcc
gacgaggtgctggcggacaacaagatccgcaaccagctgaaggaatgggaagaggctggc
tacggcaatctgccggtctgcatggcaaagacccagtactccttttcgaccgacccgtcg
ctgcgcggtgcgccggtgggccattcggtgccggtgcgcgaagtgcgcctcagcgccggt
gccggcttcatcgtggcggtctgcggcgagatcatgacgatgccgggcctgccgcgcaaa
ccggcgtcggaaaccatccgcctgaatgacgacggccagatcgaaggcttgttctaa

DBGET integrated database retrieval system