KEGG   Leisingera methylohalidivorans: METH_15110Help
Entry
METH_15110        CDS       T02961                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lmd  Leisingera methylohalidivorans
Pathway
lmd00790  Folate biosynthesis
lmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    METH_15110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmd04147]
    METH_15110
Enzymes [BR:lmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     METH_15110
Exosome [BR:lmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   METH_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AHD01838
UniProt: V9VV84
Position
complement(2939413..2939721)
Genome map
AA seq 102 aa AA seqDB search
MTEKLSDATRGPLLEPLFATGWEMVEGRDAITKTFKFSNFADAFGWMTRAAIWAEKWNHH
PEWSNVYNRVTVVLTTHDVDGISALDAKLARKMDGLFGEPQT
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaactgtccgatgccactcgcggcccgctgctggagccgctgtttgccacc
ggctgggaaatggtcgagggccgggatgccatcaccaagacctttaagttcagcaatttc
gccgatgctttcggctggatgacccgcgccgcgatctgggccgaaaaatggaaccatcac
cccgagtggagcaatgtctacaaccgggtgacagtggtgctgaccactcatgatgtggac
gggatcagtgcgttggatgccaagctggcgcgcaagatggacgggctgtttggcgaaccg
cagacttga

DBGET integrated database retrieval system