KEGG   Leisingera methylohalidivorans: METH_23410
Entry
METH_23410        CDS       T02961                                 

Definition
(GenBank) hypothetical protein
Organism
lmd  Leisingera methylohalidivorans
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: AHD03784
UniProt: V9W1G1
Position
unnamed2:complement(240916..241218)
AA seq 100 aa
MGMPQARMTDLHACMLPSTPPPPVLPVPTPILPPCAVTVLVANLPAARLGDMCTAAPAPH
PIIKGSATVLINNMPAARILDNTACGGMVVKGEFTVLVGG
NT seq 303 nt   +upstreamnt  +downstreamnt
atgggaatgccacaggcccggatgacggatttgcatgcctgcatgctgccctcaaccccg
ccgccgccggttctgccggtgccgacgccgatcctgccgccctgcgcggtgacagtgctg
gtggcgaacctgccggccgcccgtcttggggatatgtgcaccgccgcgcccgcgccgcat
ccgatcatcaaaggctctgccacggtgctgatcaacaacatgccggccgcgcggatcctg
gacaacaccgcctgcggcggcatggtcgtcaagggtgaattcaccgtgctggtgggaggt
tag

DBGET integrated database retrieval system