KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0146Help
Entry
LEUM_0146         CDS       T00411                                 

Definition
(GenBank) acetaldehyde dehydrogenase / alcohol dehydrogenase AdhE
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00010  Glycolysis / Gluconeogenesis
lme00350  Tyrosine metabolism
lme00620  Pyruvate metabolism
lme00625  Chloroalkane and chloroalkene degradation
lme00626  Naphthalene degradation
lme00650  Butanoate metabolism
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01120  Microbial metabolism in diverse environments
lme01130  Biosynthesis of antibiotics
lme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_0146
   00620 Pyruvate metabolism
    LEUM_0146
   00650 Butanoate metabolism
    LEUM_0146
  Lipid metabolism
   00071 Fatty acid degradation
    LEUM_0146
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEUM_0146
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEUM_0146
   00626 Naphthalene degradation
    LEUM_0146
Enzymes [BR:lme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEUM_0146
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LEUM_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABJ61296
UniProt: Q03ZS6
Position
127389..130091
Genome map
AA seq 900 aa AA seqDB search
MAEAIAKKPAKRVLTPEEKAELQTQAEKMTEVLIEKSQKALSEFSTFSQEQVDKIVAAMA
LAGSENSLLLAHAAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGILAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKASVLAAKIVYDAAVK
AGAPENFIQWIEKPSLYATSALIQNPHIASILATGGPSMVNAALKSGNPSMGVGAGNGAV
YIDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEILTKLQEQGAYLVPKKDY
KKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPDGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIETVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYEANAITYLQDLPTINRAFIVADPGMVQFGFVGRVLGQLELRQEQVETNIYGSVK
PDPTLSQAVEIARQMADFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILEDDEAIKD
LFLELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLADY
ELTPEVAIVDPEFVMTVPQHTVSWSGLDALSHALESYVSVMASEFTRPWALQAIKLIFDN
LTNSYNYDPKHPTKEGQNARTKMHYASTLAGMSFANAFLGLNHSLAHKTGGEFGLPHGMA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGETDAELVDVLIAEI
KKLAASVGVNQTLSGNGVSKHDFDTKLEKMIDLVYNDQCTPGNPRQPSLAEIRQLLKDQF
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcaattgcaaagaaacccgcaaaaagggttttgacccctgaagaaaaagcg
gaattacaaacacaagctgagaagatgactgaggtattgattgaaaaatcacaaaaggca
ttgtctgaattttcaacattttcgcaagaacaagttgataaaattgttgcagctatggcc
ttggcaggttctgagaattcacttctgttagcccatgctgctcacgacgagactggacgt
ggggttgtggaagataaggatacgaaaaatcgtttcgcctcagaatcagtttataacgct
attaagtttgataagactgtgggtgttattagtgaagacaagattcaaggtaaggtagaa
ttagcagccccacttggtattttggctggaatcgtcccaacgacaaatccaacgtcgaca
actattttcaaatcaatgttgacagcaaagacacgtaacacaattatctttgctttccat
ccccaggctcaaaaagcatcggttcttgctgcaaaaattgtttatgatgctgctgttaaa
gcaggcgcaccggaaaactttatccaatggattgaaaagccttcactttatgcaacaagt
gcgctgatacaaaatcctcacattgcttcaattctagctactggtgggccatcaatggtt
aatgcagctttgaagtcaggaaatccatccatgggtgtcggtgctggaaacggtgcagtt
tatattgatgcaactgttgacacagatcgtgccgtgtccgatttgttgttatcaaagcgt
ttcgataatggcatgatttgtgccacagaaaactcagccgttattcaagcaccaatctat
gacgaaattttaactaagttacaagaacaaggtgcataccttgttcctaagaaagactac
aaaaaaattgctgattatgtatttaagcctaacgcagagggatttggtattgctggtcct
gttgctggtatgtcaggacgttggattgctgagcaagcaggcgtaaagattcctgatggt
aaagatgtacttttgttcgaattagatcagaagaacataggtgaagcgttatcttctgaa
aagttatcgccattactttcaatttataaagttgagaagcgtgaagaagctattgagact
gttcaatccttgttaaactatcaaggcgcggggcacaacgcagcaattcaaattggttca
caagatgatccattcattaaagagtatgctgacgctattggtgcatcacgtattttggtt
aaccaacctgactcaatcggtggtgttggagatatttacacagatgctatgcgtccatcg
ttgacacttggtaccggatcatgggggaagaattcattgtctcataacttatcaacatac
gacttacttaatattaagaccgtggctcgccgccgtaatcgtcctcaatgggttcgttta
cctaaggaagtttactacgaagccaatgccattacttacttacaagacttgcctactata
aaccgtgcatttattgtcgctgatcctggtatggttcagttcggatttgttggcagagta
ctaggtcaacttgagttacgtcaagaacaggttgaaacaaatatctatggttcagttaag
cctgacccaactttgtcacaagctgttgaaattgctcgccaaatggcagacttcaaacca
gatacagttattttacttggcggtggttcggcacttgacgctggtaaaattggtcggttc
ttgtacgaatactcgacacgccatgaaggaattttagaagatgacgaggcgattaaagat
ctattcttagaactacaacaaaagtttatggatattcgtaagcgaatcgttaagttttac
cacgcacgtttgacacaaatggttgcgattccaacaacttcaggtactggatcagaagtc
acaccatttgccgttattacagatgatgaaacacatgtaaagtatccactagccgattat
gaattgacaccggaagttgctattgttgatccagaatttgttatgaccgtaccacaacac
acggtatcttggtcaggattagatgctttgtcacatgctttggaatcgtatgtctcagtg
atggcttctgaattcacacgtccttgggcattacaagctattaagttgatttttgataac
ttaacaaattcatacaattatgatcctaaacacccaactaaggaaggtcagaatgcacgc
acaaagatgcactatgcgtcaacattggctggtatgtcatttgcgaatgccttcttggga
cttaaccactcactagcacacaaaactggtggagaattcggactacctcacggtatggca
atcgctattgcaatgccacatgtgattaagtttaatgcggtaacaggaaatgtaaagcgc
acaccatacccacgttacgaaacctatacagcacaaaaagattatgctgatattgcacgt
tacttaggtttgaaaggtgaaacagatgctgaattggtcgatgtattgattgcagaaatc
aagaagttggctgcatcagtgggtgtcaatcaaacactatctggcaacggtgtttcaaag
catgactttgatacaaagttagaaaagatgattgacttagtttacaatgaccaatgcacg
ccgggaaaccctcgccaaccaagcttggcagaaattcgtcaattgttgaaagatcagttt
taa

DBGET integrated database retrieval system