KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0209
Entry
LEUM_0209         CDS       T00411                                 

Definition
(GenBank) SSU ribosomal protein S8P
  KO
K02994  small subunit ribosomal protein S8
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LEUM_0209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lme03011]
    LEUM_0209
Ribosome [BR:lme03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    LEUM_0209
  Archaea
    LEUM_0209
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-ProteinID: ABJ61340
UniProt: Q03ZN2
Position
179080..179478
AA seq 132 aa
MSMTDPIADFLTRVRNANLARHEVVEAPASKIKKSIAEILKAEGFIRDFEYIDDNKQGVI
RVFLKYGEDRNRVITGIQRISKPGLRKYAKAEELPKVLNGLGIAIISTSAGVITDKEARS
KQVGGEVIAYVW
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtctatgactgatccaattgctgattttttgactcgcgttcgtaatgccaatttggca
cgtcacgaagtagttgaagctccagcatcaaaaattaagaagagcatcgctgaaatcttg
aaagcagaaggttttatccgtgactttgaatacatcgatgacaacaagcaaggtgttatc
cgtgtatttctcaagtatggggaagatcgtaatcgtgtgattacaggaattcaacgtatc
tctaagccaggcttgcgtaagtatgctaaggctgaagagttaccaaaagttttgaacggt
ttgggaattgctattatctcaacttctgccggtgttattactgacaaagaagcacgttct
aagcaagtcggtggcgaagttatcgcttacgtttggtaa

DBGET integrated database retrieval system