KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0300Help
Entry
LEUM_0300         CDS       T00411                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00450  Selenocompound metabolism
lme00970  Aminoacyl-tRNA biosynthesis
lme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LEUM_0300
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LEUM_0300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lme01007]
    LEUM_0300
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lme03016]
    LEUM_0300
Enzymes [BR:lme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LEUM_0300
Amino acid related enzymes [BR:lme01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LEUM_0300
Transfer RNA biogenesis [BR:lme03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LEUM_0300
 Prokaryotic type
   Other AARSs
    LEUM_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABJ61426
UniProt: Q03ZE6
Position
255378..257486
Genome map
AA seq 702 aa AA seqDB search
MSEPNNILFNTGNHTDSAVIYDKFSKAEQQFSVKKDKTFYITTPIYYPSGKLQLGNTYTT
VLADAAARYHRLLGEDVYFLTGTDEHGLKIQQKAEAAGISEIDFLDGMAKQIKDLWKLMD
ISYDDFIRTTEDRHEKAVAKIFTQLLENGDIYKGEYEGWYSVSDEEYFTESQLAEVYRDD
AGKVIGGKAPSGHEVELVKEEAYFFKMSKYADWLLDYYKTHPEFIQPEARMNEMINNFIA
PGLEDLAVTRTSFDWGISVPGDEKHVIYVWIDALANYITALGYNSDDTTLFDKFWPANVQ
LVGKEIVRFHTIYWPIMLHALGLELPKSVVGHGWLVMKDGKMSKSKGNVIYPEVLEERYG
LDAVRYYLLRSMPFGNDGVFTPEDFVARVNYDLANDLGNLLNRTVAMINKYVDGVIPELL
TGKTSFDEDLVRTVEDAIVEYNKNFKELRTADALESVWKIIRRANKYIDETQPWVLAKDE
NEKEVLSSVMAHLAGALRVTAVLLQPVLTQAPKKIFDQLGLDYSDKGVAIAGLTFSKLPT
GGHVVKKGEPIFPRQDVEEEVAFISGLVSKDTKGKGRAVKEAAKEAAQVAPSKDLITYDD
FDKVEILAAKITAGEIVAKSEKLLKFTLDDGSGKPRQILSGIRKWYSDPAALVGKTVAIV
ANMKPRKMAGELSEGMILSAEKNDIVTVTILPDSIEPGSGIE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccaaataatattttgtttaataccggaaatcacactgattcggctgtcatt
tatgacaagttttcaaaggcagaacagcaattttcagtaaaaaaggataagaccttttat
attaccacgccaatttactatccgtctggtaagttgcagttgggaaacacttacacaacg
gtgcttgctgatgcagcagcacgataccaccgcttactgggtgaagatgtttatttttta
acaggtacagatgaacatggattgaaaattcaacaaaaagctgaggctgcgggtatatct
gaaatagattttcttgatggtatggcgaagcaaattaaagacttgtggaagctaatggat
atttcatatgacgattttattcgcactacagaagatcgccatgaaaaagcagtcgctaaa
atctttacgcaattactagaaaatggggatatttataaaggtgagtatgaaggttggtac
tctgtttctgatgaagagtactttacagaatctcaattagccgaagtctatcgtgatgac
gcaggcaaagtaattggtgggaaagcaccatcagggcatgaagttgagttagttaaagaa
gaagcatacttcttcaagatgagtaaatacgctgattggttacttgattattacaaaaca
catccagagtttattcagccagaagctcgaatgaatgagatgattaataatttcattgca
ccaggtctggaagatttagcggtaacacgtacatcatttgactggggtatttcagtacca
ggggatgagaagcatgtgatttacgtttggattgacgcattagctaactatattactgct
ctaggttataattcggacgatacaaccctatttgataagttctggcctgcaaacgttcaa
cttgttggaaaagaaatcgttcgtttccatactatttattggccaattatgttgcatgca
ttgggattagagttgcctaaatcagttgtaggtcatggttggcttgtgatgaaagacggt
aagatgtctaaatcaaagggtaatgtaatctatcctgaagtgcttgaagaacgctatggt
ctagatgcagttcgctattatttattgcgttcaatgccatttggtaatgatggtgtattt
acacctgaagattttgtggcgcgtgttaactatgatttagctaatgatttaggtaatttg
ttgaatcgtacagtagccatgattaataagtatgtggatggggttattcccgagctacta
acaggtaagacttcttttgatgaagacttggttcgaactgtagaagatgccattgttgaa
tacaacaaaaactttaaagaattacgtactgctgacgcacttgaaagtgtttggaaaatc
atccgtcgtgcaaataagtatattgatgagacacaaccatgggtgttggcaaaagatgaa
aatgaaaaggaagttttgtctagcgtaatggctcatttagctggtgcattacgggttact
gctgttttgttacagccagtattaacacaagcaccaaagaagatttttgatcaattaggc
ttagattattctgacaaaggtgttgctattgcaggtttgactttcagtaagttaccaact
ggcggtcatgttgtcaagaagggtgaaccaattttcccacgccaagacgttgaagaagaa
gtggcctttatttcaggactagtttcaaaagataccaaaggtaaagggcgtgcggttaaa
gaggcagcaaaagaagcagctcaggtggcgccatctaaggatttgattacttatgatgat
ttcgataaagttgaaatcttggctgctaaaattacggcaggagaaattgttgctaaatct
gaaaaattgttaaagtttacgcttgatgatggatcagggaagccacgccaaattttgtcg
ggtattcgtaaatggtattcagaccctgctgctttggtgggtaaaacggttgctattgtt
gccaatatgaagccacgaaaaatggctggtgaactttctgaagggatgattttgtcggct
gagaagaatgatattgttactgtaacgatattgccggattcaattgaaccgggttcagga
attgaataa

DBGET integrated database retrieval system