KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0445Help
Entry
LEUM_0445         CDS       T00411                                 

Definition
(GenBank) Lactate dehydrogenase related enzyme
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD NAD_binding_2 IlvN Shikimate_DH NAD_binding_7 F420_oxidored XdhC_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABJ61561
UniProt: Q03Z11
Position
405143..406072
Genome map
AA seq 309 aa AA seqDB search
MKKVLVANMTSQKAVDYLESKGYQVIKNDQASDDDFLGHADVDGILIMMHPFGESLMSKM
PNLKVVARHGVGYDNVDLDAASAHDIVVTNTPGANATAVAETAMMHILMAGRLFYQRRQA
ITDNANKRYLAAHHGQELTGKTVGIIGYGHIGQEINRMLTGFNVKVLAYARHQHEVTNGR
MATLDEIYEQADFVVTALPATPETKHMINASVFRKMKKSAVLVNIGRGALVDERALVEAL
TNEEIAGAGVDVVEKEPITAENPLLHLPNAFVTPHVAMISKEAMDNVALKAAEDIVRVLE
GERAVFQVN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtattagtagctaacatgacatctcaaaaagctgtcgactatcttgaatcc
aagggatatcaagtgattaaaaatgatcaggcctcagatgatgattttctggggcatgca
gatgttgatggcattctaattatgatgcatccatttggtgaaagcttgatgtccaaaatg
cccaatctcaaggtagttgcacgtcacggcgttggatatgataatgttgatttagatgca
gccagtgcacatgatattgttgtgaccaacacgcctggagcgaatgcaactgcggtcgcc
gaaacggctatgatgcatatattgatggctggacgactgttttatcagcgtcgtcaagct
attactgataacgcgaacaagcgttacctagccgcgcatcacggtcaagagttaactgga
aaaacagttggtattattggctatgggcacattggccaagaaattaatcgtatgttgacg
ggatttaatgtaaaagtattggcttatgcacgccatcaacatgaggtaactaatggtcgc
atggcaacgctagatgagatatatgaacaggcggattttgtagtgacagcgctcccagca
acgcctgaaacaaagcatatgatcaatgcgagtgtttttagaaaaatgaaaaagagtgcc
gtattagttaatatcggacgtggagcacttgttgatgagagggcattggttgaggcatta
actaatgaggaaattgctggcgctggggtagatgttgttgaaaaagaaccaattacagcg
gaaaatccattactacacttgcctaatgcatttgttacaccacatgtcgctatgatttcc
aaggaggccatggataatgtagctttgaaagcggcagaggatatcgttcgtgtcttggaa
ggtgaacgagctgtatttcaagtgaattaa

DBGET integrated database retrieval system