KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_0912Help
Entry
LEUM_0912         CDS       T00411                                 

Definition
(GenBank) Threonine dehydrogenase related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LEUM_0912
Enzymes [BR:lme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LEUM_0912
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LEUM_0912
    1.1.1.-  
     LEUM_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Pyr_redox_2 2-Hacid_dh_C FtsJ PrmA TrkA_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABJ62018
UniProt: Q03XQ4
Position
914870..915919
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDVRVEDVELKPTKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDQPDELT
GGQAPLTMGHEFSGVIEKVGPDVANFKVGDHVSINPTVTKGISSDDLDVYDGYSFIGLST
DGGFTSYVNVPEDNLYHLPEEFSLKLAATIEPTAVAVQAIKEADLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSEIRLRKALEMGATDVINPSQVPDTVAAIKNIIPGGADAS
FEVAGVQPTFEQAIDATRPRGSVVIVSIFAKPISFNPMQLMNAGVKLTTTIAYSKETFQQ
TVALVSSGQINVEPVITDTISLDSIVSDGFESLTSDKSQAKILIDLSKD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggcgttaaagatgttcgtgtggaggatgttgaactcaaa
ccaacaaaatctaatgaggtagtagtgcgtgttgcttatgctgggatttgtggcagcgac
ttacacgagtaccttgagggtcctgtatttattcccgttgatcaaccagatgaattgact
ggcggtcaagcaccattaacgatgggacatgagttttctggcgttatcgaaaaagtaggt
cccgatgtggctaattttaaagttggggatcacgtttcaattaatccaactgtcacaaag
ggaatttcttctgatgatttggatgtttacgatggctatagttttattggtttaagcacg
gatggtggctttacatcatacgtgaatgtaccagaagataacttatatcatttacctgaa
gaattctcattgaaattagcagctactattgagccaactgcagttgcggtccaagctatc
aaagaggctgatcttcgatttggcgaaaaagttgtgatttttggtgctggaccaataggt
gtattagttgctgctgctgcgaaggcggcaggggctactaaaatcgtggctgtagatttg
tcagaaattcgcttgagaaaagcgcttgaaatgggcgcaacagacgtgattaatccaagt
caagtaccagacactgttgcagctattaaaaacattattcctggtggagcggatgcatca
tttgaagttgccggggtacaaccaacctttgaacaagcaatagatgcaacacgtccgcgc
ggaagtgtcgttattgtttcaatttttgcaaagccaatcagctttaacccaatgcaattg
atgaatgcaggtgttaaactgaccacaacaattgcttattcaaaagaaactttccaacaa
actgttgctcttgttagcagtgggcaaataaatgtagaaccagttattacggatacaatt
tcattggacagtattgtttctgatggttttgagtcattaacaagcgataaatcgcaggcc
aagattttaattgatttaagtaaagattaa

DBGET integrated database retrieval system