KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1233Help
Entry
LEUM_1233         CDS       T00411                                 

Definition
(GenBank) Lactate dehydrogenase related dehydrogenase
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD NAD_binding_7 XdhC_C Shikimate_DH IlvN
Motif
Other DBs
NCBI-ProteinID: ABJ62331
UniProt: Q03WU1
Position
complement(1227819..1228757)
Genome map
AA seq 312 aa AA seqDB search
MSEKRIHIVGDLHEVAIQKFTSAGYDVSHSPNYDEKKLLSLASDAAVIIMTDMAFDKNWF
DALPNLKLIARRGVGYDNIPVESATKHGVWVTNTPGANAIAVAELAVTLILTVLRKVNQA
TNSVQKGEALTYPASLMGHNLSGKIIGLIGYGQIAQNLEKILHGFGAHVLVYSRTKRETL
YGQFVSYDTLLAQSDIISLHIPATPETSGILNHEAFSKMKTNAILINTARAALVDEEALV
EAINTGKIAGAGLDTTSYETIKTASPLLNHDQIVITPHIGANTVESEYLTAEKVVASVLD
FFNNQKPIYRLN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaacgcatacacattgtaggtgatttacacgaagttgctattcaaaaattt
accagtgcaggatatgatgtatcgcatagcccgaattatgatgaaaaaaaattattgtcc
ttagcttctgatgcagcggtcattattatgactgatatggcatttgacaagaattggttt
gatgccttgccaaatctaaaattaatcgcccgtcgtggtgtaggatatgataacattccg
gtggaatcagctaccaaacacggtgtgtgggtgacaaatacacccggtgcaaatgctatt
gctgttgcggaactggctgttactttgatattaacagttttgcgtaaggtcaaccaagca
accaatagcgtgcaaaaaggtgaggcattaacatatccagcaagtttaatgggtcataat
ttatctgggaaaataataggactcatcgggtatggtcaaattgcgcaaaatttagaaaaa
atattgcatggttttggggcgcatgtattggtttatagtcgaacaaagcgagaaacgctt
tatggtcaatttgtatcgtatgacacactactagcacaatcagatatcatatcgttacat
attcctgctacaccagaaacaagtggtattttaaatcatgaagcgttttcaaagatgaaa
acgaacgctattctaattaatacagcacgagctgctttagtagatgaagaggcgttggtt
gaggcaataaatactggaaaaatagcaggtgcaggtctagacacaacaagttatgagacc
ataaaaacagctagtcctttattgaatcatgatcaaattgtgattacaccacatattggt
gcaaatacagtagaatccgaatacttgactgctgaaaaagtagtggcaagcgttcttgat
ttttttaacaaccaaaagccgatatacagattaaactag

DBGET integrated database retrieval system