KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1318Help
Entry
LEUM_1318         CDS       T00411                                 

Definition
(GenBank) Phosphoglycerate dehydrogenase related enzyme
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DapB_N NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABJ62414
UniProt: Q03WK8
Position
complement(1309618..1310562)
Genome map
AA seq 314 aa AA seqDB search
MALLLAVKAITQENREFLAQYDISVVTPDTITDEQLPEVLISYAWDTEIGHKILANPESK
LKWIQAQSAGVDYLPLKTLQERQITVTNASGLKAVPIAQTVLGYILHFARGLNVYSTRKH
WEPFTDQYLMSELPVLVFGTGRIGQQIAHAVKSLGGVVFGVNTTGRPVEGFDATYAISDY
QEALAKSQVVVDGLPGTKETENFFDEHFFQQFNQLFLFINIGRGTTLNQDDLLSAIDDSR
VKYAALDVTTPEPLPMNHPLFERPQILLTQHTSWGEQESAGRVGGLFRLFEKNVPSFMAD
GTFVQNVVDLNKGY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcattattactggcagtgaaagcaataacgcaagaaaatcgtgaatttcttgcacaa
tatgatattagcgttgtgacaccggacacgattaccgatgagcaattacctgaggtattg
ataagttatgcttgggatacagaaattgggcataaaatccttgctaacccagaatcaaaa
ttaaagtggattcaggcgcaatcggctggtgttgactacttacccttgaaaacactacag
gagcgtcaaattactgtgacaaatgcgagtgggttaaaagcggtacctatagctcaaact
gttttgggctatattctccactttgctcgtggcttaaatgtttattctacacgaaaacat
tgggagccttttacagatcagtatttgatgagtgaattaccagttttggtgtttggtact
ggtcgaattggacagcaaattgctcacgctgtaaaatcattgggcggtgtagtttttggt
gtaaatactacaggtcgtccagttgaaggattcgatgcaacttatgcgatttctgactat
caagaagcactagctaaatcgcaagttgttgttgacgggttaccagggacaaaagaaacc
gaaaacttttttgatgagcattttttccaacagtttaatcaattgtttttgtttatcaat
attgggcgtggcacaactttgaatcaggacgacctactttcagcaattgatgattctcgt
gtcaaatatgctgcattagacgtcacaacacctgaaccattaccaatgaatcatccatta
tttgagcggccacaaatcttattgacacaacatacaagttggggtgaacaagaaagtgct
ggtcgtgttggtggattatttcgtttgtttgaaaaaaatgttccttcatttatggctgat
ggtacgttcgttcaaaatgttgttgatctaaataaaggatattga

DBGET integrated database retrieval system