KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1546Help
Entry
LEUM_1546         CDS       T00411                                 

Definition
(GenBank) Putative transcription activator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00730  Thiamine metabolism
lme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LEUM_1546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lme03000]
    LEUM_1546
Enzymes [BR:lme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     LEUM_1546
Transcription factors [BR:lme03000]
 Prokaryotic Type
  Other transcription factors
   Others
    LEUM_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ABJ62638
UniProt: Q03VY4
Position
1547324..1548028
Genome map
AA seq 234 aa AA seqDB search
MFSEELRTQAAPIMTAIHDHAFVRGIADGYVPREALIFYVEQDFQYLSEFIKIYANAITK
LTDRNEMKFFADSIDFILNSEIHPHHVFCDVAGVEYETLQHATPTPKAYLYESHMYRAAD
TGSLLNILAAFQACPWTYNEIAKKQVQEKANTNDNPFKSWIDFYDNTDDDPEVSLSDKIF
EWIDRLAENATTQQRQQATQFFLKSCELEWQFWEQAYHQEDWRFKDVLNQANSL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagaagaattgcgcacccaagctgcaccaattatgacagccattcatgatcac
gcatttgttcgtggcatcgcggacggttacgtcccccgagaagctttgattttttacgtt
gaacaagatttccaatatcttagtgaatttatcaaaatttatgccaatgccattacaaaa
ttaactgatcgtaatgaaatgaaattttttgctgattcaattgatttcattttaaatagc
gaaattcatccccatcatgttttttgtgacgttgccggcgtcgaatatgaaacattgcaa
cacgccacgccaacacctaaagcatatctatacgaatcacatatgtatcgtgcggctgac
accggctccttattaaatattctagctgcttttcaggcgtgcccttggacctataatgaa
attgcaaaaaaacaagttcaggagaaagcgaacacaaatgataacccattcaaaagctgg
attgatttttatgataatacagatgatgatccggaagtttcactatctgacaaaatcttt
gaatggatagatcgcttggcagaaaatgcaacaactcaacaacgccaacaggccacacag
ttttttcttaaaagttgtgaattagaatggcagttctgggaacaagcctaccaccaagaa
gactggcgcttcaaagatgtattaaatcaggcaaactctttgtaa

DBGET integrated database retrieval system