KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1596Help
Entry
LEUM_1596         CDS       T00411                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00010  Glycolysis / Gluconeogenesis
lme00260  Glycine, serine and threonine metabolism
lme00680  Methane metabolism
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01120  Microbial metabolism in diverse environments
lme01130  Biosynthesis of antibiotics
lme01200  Carbon metabolism
lme01230  Biosynthesis of amino acids
Module
lme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_1596
  Energy metabolism
   00680 Methane metabolism
    LEUM_1596
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEUM_1596
Enzymes [BR:lme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEUM_1596
Membrane trafficking [BR:lme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LEUM_1596
Exosome [BR:lme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEUM_1596
  Exosomal proteins of melanoma cells
   LEUM_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABJ62688
UniProt: Q03VT4
Position
complement(1599199..1599861)
Genome map
AA seq 220 aa AA seqDB search
MAAKLVLVRHGESTANRDNEFTGWTDVPLTLKGVRQANRVGEVLKRHGLQFDVSFTSFLK
RAIITDNIILEEIEQLWLPLHKAWQLNERHYGALRGLNKDYARQQYGANKVALWRRSYTA
TPPLLEHVIPDRRYPEDLEPRGESLKMASDRLVPYWHSEILPQIQQDKNVLIVAHGSSLR
ALVKYIEHISDEDIDGLEIDNGEPILYEYEEGFSERIYLE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaacttgtgttagttcgccacggagagtcaacagcaaaccgtgacaatgaa
tttaccggatggactgacgttccactgaccttaaaaggggttagacaagcgaaccgtgtt
ggtgaagttttgaagcgacatggtttgcaattcgatgtatcatttacttcttttttaaag
cgcgcaatcataactgacaatattatattggaagaaattgagcagttgtggttaccactc
cataaggcttggcaactcaatgagcggcactatggtgcattacgtggcttgaataaagat
tacgctcgtcaacaatatggcgcaaataaagttgccttatggcgacgtagttatacggct
acgccaccactactagaacacgttattccagatagacgttacccggaagacttagaacca
cgtggtgagagcttgaaaatggccagtgatcggcttgttccttattggcattcagaaatc
ttacctcagatacagcaggataaaaatgtcttaatcgtcgcacatggtagctccttacgt
gctttagtcaaatatatagaacatattagcgatgaagacatagacggtcttgagattgac
aatggcgaacctattttgtacgagtatgaagaaggatttagtgagaggatttatttagaa
tga

DBGET integrated database retrieval system