KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1602Help
Entry
LEUM_1602         CDS       T00411                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00900  Terpenoid backbone biosynthesis
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01130  Biosynthesis of antibiotics
Module
lme_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:lme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LEUM_1602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lme01006]
    LEUM_1602
Enzymes [BR:lme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     LEUM_1602
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     LEUM_1602
    2.5.1.29  geranylgeranyl diphosphate synthase
     LEUM_1602
Prenyltransferases [BR:lme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   LEUM_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: ABJ62694
UniProt: Q03VS8
Position
complement(1606058..1606972)
Genome map
AA seq 304 aa AA seqDB search
MIDLKSFQKEWLPKINQQLENDLSMASPDADLVAMMKYAVLNGGKRLRPLLTLAVVTSFG
ESITPSILKVATAIEWVHSYSLVHDDLPAMDNDMFRRGKPSVHALYGEANAILVGDALLT
GAFGVIATANSSCSVEDCLPTEELLLITQNLAREAGGSGMVLGQLHDMDNHTEEQNASTN
WLLNDVYSMKTAALIRYTTTLGAILTHQNVNVEDNHFDPKKAMYDFGEKFGLAFQIQDDL
DDYQQDQLEDVNSLPHIVGVKEAQSVLDQYLFSTQEILANTVEQDQQFDRRLLDDFVSLI
GDKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttaaaaagtttccaaaaagaatggcttccaaaaattaatcaacaattggaa
aatgatttatcaatggcttccccagatgctgatttagttgctatgatgaagtatgcagtt
ttgaatggtggcaaaaggctccgaccattgctgacgttagcagttgttacaagttttgga
gaatctatcacaccaagtatattgaaagtagcaacggcaattgaatgggttcattcatat
tcccttgttcatgatgatttgccggcaatggataatgatatgtttcgacgtggcaaaccc
agcgttcatgcattatatggtgaagccaatgctattttagtcggcgatgcgttattaact
ggtgcctttggagtcatagcgactgccaatagttcatgcagtgttgaggattgtcttcca
actgaagagctattattaattactcaaaacttagctcgcgaagcaggtggatcaggaatg
gttttagggcaactccatgatatggataatcacactgaagaacaaaatgctagtacaaat
tggttgttaaatgatgtttatagcatgaagactgcagcattgataagatatacaacaacg
ttgggcgcaatattgacccatcaaaatgtcaatgttgaggataatcattttgatccgaag
aaggcaatgtatgattttggtgaaaaattcggattggcctttcaaattcaagatgattta
gatgattatcagcaagatcaattagaagatgtgaactcattgccacatatagtgggtgtt
aaagaggcacaaagtgtgcttgaccaatacctcttctcaacacaagaaatattagctaat
actgttgaacaagatcaacaatttgatcgacgtttgctggatgattttgttagtttaatt
ggagataaaaaatga

DBGET integrated database retrieval system