KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1713Help
Entry
LEUM_1713         CDS       T00411                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00230  Purine metabolism
lme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LEUM_1713
Enzymes [BR:lme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LEUM_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA AAA_16 RsgA_GTPase AAA_22 NB-ARC AAA_33 cwf21 Rad17 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABJ62800
UniProt: Q03VH2
Position
complement(1684173..1684769)
Genome map
AA seq 198 aa AA seqDB search
MTQRGLLIVLSGPSGVGKGTVRKAIFEEESIDFQYSISATTRQPRAGEVDGEDYFFVTRE
QFEEKINNGDMLEYAKYVSNYYGTPKSFIDETLASGRDVFLEIDVQGALQVKSKMPEGIY
IFLTLPDLANLRDRLVGRGTDSADVIEKRVAAARDELKMMINYDYAVENDVVSNAVERIK
SIITAERLRVTRVFDKIQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcgtggtttattaatcgtactttcaggaccctcaggtgtcggaaaaggcact
gtacgtaaagcaatttttgaagaagaaagcattgattttcaatattcgatttccgctaca
acacgtcagccccgtgctggagaagtagacggtgaagattatttctttgtaacccgtgaa
cagtttgaagaaaaaattaataatggtgacatgttagagtatgcaaaatatgtcagcaac
tattacggaacacctaaaagctttatagacgagacgttggcgagcgggcgtgatgttttt
ttggaaatagacgtacaaggtgccttgcaagttaaatcaaaaatgccagaaggtatttac
atatttttgacacttccggatttggcaaatctacgcgaccgtttggtcggtcgtggtaca
gattctgctgatgtgattgaaaaacgagttgcagcggcgcgtgacgaacttaaaatgatg
attaattacgattatgctgttgaaaacgatgtggtttcaaacgcagttgaacgaatcaaa
tcaatcattacagcagaacgcctacgcgtaacgcgtgtatttgataagatacaataa

DBGET integrated database retrieval system