KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_0364Help
Entry
LMOf2365_0364     CDS       T00174                                 

Definition
(GenBank) oxidoreductase, short-chain dehydrogenase/reductase family
  KO
K22251  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00561  Glycerolipid metabolism
lmf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LMOf2365_0364
Enzymes [BR:lmf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LMOf2365_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C RmlD_sub_bind DUF853 3HCDH_N 3Beta_HSD Ldh_1_N zf-C4H2
Motif
Other DBs
NCBI-ProteinID: AAT03150
Position
complement(389179..389943)
Genome map
AA seq 254 aa AA seqDB search
MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAKINPS
RTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNL
KGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAP
YNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLI
TGENLIIDGGYTIK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaaggttttgataaagattttaacattacagacaaagtagccgtggtaact
ggggcagcaagcgggattggtaaagcaatggcagaacttttttccgaaaaaggcgcttat
gttgtcttgcttgatattaaagaagatgtaaaagatgtcgcagcaaaaatcaatccatca
agaacgctagcacttcaagtcgatattacgaagaaagaaaacatcgaaaaagtcgttgcc
gaaatcaaaaaagtctatccaaaaatcgatattttagccaattcagctggtgtcgcactt
ctcgaaaaagcagaagatttaccagaagagtactgggataaaacaatggaactgaactta
aaaggttcgttcctaatggcgcaaattatcggtcgcgaaatgattgcaactggcggcggt
aaaatcgttaatatggcctctcaagcttctgttattgcacttgataaacacgttgcctac
tgcgctagtaaagcagcgattgtttctatgacgcaagtgctagcaatggaatgggcgcct
tacaacattaatgtcaatgcgatttccccaaccgttatcttgacggaacttggcaaaaaa
gcttgggcaggtcaagtcggcgaagacatgaaaaaattaattccagccggtagatttggt
tatccagaagaagttgccgcatgcgccctctttttagtaagtgacgcagcgagccttatt
actggggaaaacctaattatcgacggtggttatacgattaaataa

DBGET integrated database retrieval system