KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_1277Help
Entry
LMOf2365_1277     CDS       T00174                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00330  Arginine and proline metabolism
lmf00332  Carbapenem biosynthesis
lmf01100  Metabolic pathways
lmf01130  Biosynthesis of antibiotics
lmf01230  Biosynthesis of amino acids
Module
lmf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LMOf2365_1277 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LMOf2365_1277 (proB)
Enzymes [BR:lmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LMOf2365_1277 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase OSK
Motif
Other DBs
NCBI-ProteinID: AAT04052
UniProt: Q720G2
Position
complement(1266950..1267780)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLSVRPTSIPDLQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLDSLLSRGIIPIVNENDTVAVEELEHVTKYGDNDLLSAIVAKLVQADLLIMLSDID
GFYGSNPATDPEAVMFSEINQITPEIEALAGGRGSKFGTGGMLTKLSAASYCMDSNQKMI
LTNGKNPTVIFNIMQGEQIGTLFASKKEELSHDRTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaaaaatagtaagagattagtcatcaaagttggtacaagtacatta
atgtatggaaatggccatataaatttacgtaccattgagaaattagcgatggttttatct
gatttacgtaacgaaggaaaagaggtcattcttgtttcttctggggcaatcggtgttggt
tgtcataaattacagctttcagtaagacctacaagtatccctgaccttcaagctgtcgcg
tcggttggtcaaagtgaactaatgcatatttatagtaaattttttggtgaatatggacaa
gtggttggacaggtgttgcttacacgtgatgtaactgacttccctattagccgcgaaaat
gttatgaatactttagacagtttattaagccgtggtattatccctatcgtaaatgaaaat
gataccgttgctgtagaagaactggagcatgtaacgaaatacggggataatgatcttctt
tcagccattgtcgctaaactggttcaagctgatttgcttattatgctttctgatattgac
ggcttttatggtagtaaccctgcaacagatccagaggctgttatgttctctgaaatcaac
caaatcactccagaaattgaagcccttgctggaggacgcggttctaaatttgggactggt
ggtatgttgaccaagctttctgctgcttcttattgtatggattctaaccaaaaaatgatt
ttaacaaacggtaaaaaccctaccgtcatttttaatattatgcaaggtgaacaaattggt
actttattcgcaagtaaaaaggaggaactttcacatgaccgaactcattaa

DBGET integrated database retrieval system