KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_1433Help
Entry
LMOf2365_1433     CDS       T00174                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00071  Fatty acid degradation
lmf00072  Synthesis and degradation of ketone bodies
lmf00280  Valine, leucine and isoleucine degradation
lmf00310  Lysine degradation
lmf00362  Benzoate degradation
lmf00380  Tryptophan metabolism
lmf00620  Pyruvate metabolism
lmf00630  Glyoxylate and dicarboxylate metabolism
lmf00640  Propanoate metabolism
lmf00650  Butanoate metabolism
lmf00900  Terpenoid backbone biosynthesis
lmf01100  Metabolic pathways
lmf01110  Biosynthesis of secondary metabolites
lmf01120  Microbial metabolism in diverse environments
lmf01130  Biosynthesis of antibiotics
lmf01200  Carbon metabolism
lmf01212  Fatty acid metabolism
lmf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOf2365_1433
   00630 Glyoxylate and dicarboxylate metabolism
    LMOf2365_1433
   00640 Propanoate metabolism
    LMOf2365_1433
   00650 Butanoate metabolism
    LMOf2365_1433
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOf2365_1433
   00072 Synthesis and degradation of ketone bodies
    LMOf2365_1433
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOf2365_1433
   00310 Lysine degradation
    LMOf2365_1433
   00380 Tryptophan metabolism
    LMOf2365_1433
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOf2365_1433
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOf2365_1433
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOf2365_1433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmf04147]
    LMOf2365_1433
Enzymes [BR:lmf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOf2365_1433
Exosome [BR:lmf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOf2365_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAT04208
Position
complement(1423576..1424745)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system