KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_1557Help
Entry
LMOf2365_1557     CDS       T00174                                 

Gene name
glpK-2
Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00561  Glycerolipid metabolism
lmf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LMOf2365_1557 (glpK-2)
Enzymes [BR:lmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LMOf2365_1557 (glpK-2)
Exosome [BR:lmf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOf2365_1557 (glpK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAT04332
UniProt: Q71ZD2
Position
complement(1553061..1554554)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKDGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPKAMLPEVRPSSEVYADTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDKRFEVEMKDEQRE
DLYEGWHKAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatatattttagcactggatcaaggaacaacgagttcaagagcgatgatt
attgacgaagaaggagaagtaattggcgttgcacaagaagaatttgatcaaatttttcct
aaaccaggttgggttgaacataatgccaatgaaatctgggcttcgattttagctgttatt
gcaggcgtattactcaaaacaaatatttcttctaaagaaattgctgggattggtattaca
aaccaacgtgaaactactgttatttgggataaagaaagcggaaatccaatttataatgcg
attgtttggcaatctcgtcaaacagaagatatttgtaaacaattacgtaaagacggctat
gaagataccattcgttctaaaactggtcttttgattgatccgtattttgcgggtacaaaa
gctcgctggattctcgaccatgtagatggtgcgcaagaacgtgctgaaaaaggagaactt
cttttcggaacaatcgatacttggttagtttggaaattaactggtggtcgtgctcatatt
acagattattccaatgcttctcggacacttctttataatatttacgatttagagtgggat
gatgaacttctaaaaatgcttaatatcccaaaagcaatgttacctgaagttcgtccttcc
tctgaagtgtatgcggacacagtgccttatcacttctttggtgaagaagtgccggttgca
ggtattgctggtgaccaacaagccgctttattcggacaaggttgttttgaaaaagggatg
gcgaaaaatacttatggaactggttgtttcttactaatgaacactggggaaaaagcagtc
cgttctgaaaacggcttattaacaacactagcttggggaattgatggaaaagtagaatat
gcacttgaaggtagtatattcgttgctggttcggctattcagtggttacgtgacgggtta
cgaatggttcgtcaatcaagcgattctgaaaactatgcgagccggattgaatctagtgat
ggtgtatatgttgtaccagcattcgttggtttaggcgcaccttactgggattccgatgtt
cgtggtgctgtttttggattaactcgtggtaccgaaaaagaacaatttatccgtgcgaca
ttggaatctcttgcttatcaaacaagagacgtgctttatgcaatggaacaagattctggt
attagcttaaaaacgttacgtgtggatggcggggcttctgctaataacttcttaatgcaa
ttccaatccgatattctaggcgttccggtagaacgtccagaaaacaaagaaacaaccgtt
ctaggtgcggcattcttagctggacttgcggtaggcgtttggaaagacaaaaacgaaatt
aaaaaacattggaaactagacaaacgttttgaagtagaaatgaaagatgaacaaagagaa
gatttatatgaaggttggcataaagctgtcaaagctgcacaagcctttaaataa

DBGET integrated database retrieval system