KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_1605Help
Entry
LMOf2365_1605     CDS       T00174                                 

Definition
(GenBank) thiol peroxidase
  KO
K11065  thiol peroxidase, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Brite
KEGG Orthology (KO) [BR:lmf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMOf2365_1605
Enzymes [BR:lmf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     LMOf2365_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: AAT04380
UniProt: Q71Z84
Position
complement(1605213..1605710)
Genome map
AA seq 165 aa AA seqDB search
MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVC
STQTRKFNEEASNLDNTVVLTISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVV
MKELRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIEAAKKA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtaacatttaaacataatccagttacactcgtaggtaccgaaagaaaagtt
ggcgacaaagcgccgaacttcacagtggtgaatagagatttagaagaagtaacattgcac
gattatgacgggaaagtgagacttatcagcgttgttccttccattgatacaagtgtttgt
tccacacaaacgcgtaaatttaatgaagaagcaagcaatttagataatacagttgtctta
actatctccgttgatttaccatttgctcaaaagaaatggtgtgccgcagaaggtttacca
aatgcgattacattatctgatcaccgcgatctttcttttggcgaagcatacggtgtagtc
atgaaagaacttcgcttactagctcgttctgtttttgtggtaaatgcagcaggggaaatc
gtctacacggaagtagttccagaaggtagcgatcatccgaattatgaagcagcgatagaa
gcagccaaaaaagcttaa

DBGET integrated database retrieval system