KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_1642Help
Entry
LMOf2365_1642     CDS       T00174                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf00300  Lysine biosynthesis
lmf01100  Metabolic pathways
lmf01120  Microbial metabolism in diverse environments
lmf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LMOf2365_1642
Enzymes [BR:lmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LMOf2365_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 UPF0164
Motif
Other DBs
NCBI-ProteinID: AAT04416
Position
complement(1640816..1642228)
Genome map
AA seq 470 aa AA seqDB search
MTEINWQKEVESRKDDFLEDLKGLLRIPSVRDDSKKTEDAPFGPDVKRALDYMIELGKKD
GFTAKEVGNVAGHLEYGQGEELVGVLGHVDVVPVGDGWTNGPFEPTLRDGKLYARGVADD
KGPTIAGYYALKIIKELGLPLSRRVRIIVGSDEESGMSCVERYFETEEQPTLGFVPDAEF
PIIHAEKGISELDVSFKDGEASGEAAFRLLSVESGERYNMVPDHATAILEDVKDFDKLAS
AFKTFLANHPVEGTLEENGKSVKINIVGKSAHAMEPNNGVNAGLHLVAFLGKFKLTGAAN
DFVTFGRDYLFGDSRAVKLGISYEDEESGELTMNVGVIRYDVAEGGKYGLNFRYPVTANM
DKLKNKMQTVVYEYNAQYTHYEDSKPLFVPKDHPLIQVLQEVYTKQTGEEATLLAIGGGT
YARHMETGVAFGALFPGREDTMHQKDEFSYFDDLLKATAIYAEALYKLAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattaattggcaaaaagaagtggaatcacgcaaagatgatttcttagaagat
ttaaaagggcttcttcgcattccgagtgttcgcgatgacagtaaaaaaacagaagatgcg
ccgtttggaccagacgtgaaacgcgcgctcgactatatgattgaacttggtaaaaaagac
ggcttcacagcgaaagaagttggaaacgtagcaggacaccttgaatatggtcaaggagaa
gaactagttggcgttttaggccatgtggatgtagtaccagttggtgatggttggacgaac
ggaccattcgaaccaactttacgcgacggcaaattatacgctcgtggggttgcggacgat
aaaggaccaacaatcgcaggttactatgcgctaaaaattattaaagaactaggattacca
ctttctcgccgtgttagaatcattgttggttctgatgaagagagcggtatgagctgtgtg
gaacgttattttgaaacagaagaacaaccaacacttggttttgttcctgatgcagaattc
ccaatcattcacgcggaaaaaggtatctcagaactagatgtatcttttaaagatggtgaa
gcaagcggggaagcggctttccgtttacttagcgtagaatcaggtgagcgttacaacatg
gttccagatcacgcaacagctattttagaagacgtaaaagactttgataaattagcgagt
gcattcaaaaccttcctagcaaaccatccagtagaaggaacattagaagaaaacggcaaa
tccgttaaaattaatattgttggtaaatctgcccatgcaatggaaccaaataacggtgta
aacgctggtcttcatttagtagctttccttggtaaattcaagctgactggcgcggcaaat
gatttcgtaacatttggtcgcgattacctattcggcgattcccgtgcagttaaattaggt
attagctatgaagacgaagaaagcggcgaactaacaatgaacgttggcgttattcgttat
gatgtagcagaaggtggaaaatacggacttaatttccgttatccagtaactgctaatatg
gacaaattgaaaaataaaatgcaaacagtggtttatgagtacaacgcgcaatacacgcat
tacgaagattccaaaccacttttcgtaccaaaagatcatccgctaattcaagttttacaa
gaagtgtatacaaaacaaacgggtgaagaagctactttactagcaattggtggcggaact
tatgcgcgccacatggagactggtgtggcgttcggcgcactattcccaggccgtgaagac
acgatgcaccaaaaagacgaattcagctattttgatgatttgttaaaagctactgcaatt
tatgcagaagcactttacaaattagcgaagtaa

DBGET integrated database retrieval system