KEGG   Listeria monocytogenes F2365 (serotype 4b): LMOf2365_2682Help
Entry
LMOf2365_2682     CDS       T00174                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
lmf  Listeria monocytogenes F2365 (serotype 4b)
Pathway
lmf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOf2365_2682 (recR)
DNA repair and recombination proteins [BR:lmf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LMOf2365_2682 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LMOf2365_2682 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5
Motif
Other DBs
NCBI-ProteinID: AAT05447
UniProt: Q71W69
Position
complement(2729435..2730031)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatagatagttttatgaaattaccaggaatt
ggaccaaaatcggcagctcgactagctttttatgtgttagatatgaaagaagacgatgtg
ctagattttgcaaaagcccttgttgatgcgaagcgaaacctaagcttttgttccgtttgt
ggtcacattacagataaggatccatgttatatttgcgctgatacgtcacgcgatcgaagt
gttatctgtgtagtacaagaatccaaagatgtcattgcaatggaaaaaatgcgtgatttt
catggcttataccatgtacttcatggaacaatttcgccaatggatggaattggaccagaa
gatattaacattcctgatttgctgaaacgtttgcaagatgacacgattgaagaagttatt
ttagcaaccaaccctaatgttgaaggagaagccacggcgatgtatatttcgcgcttatta
aaaccttcaggcataaaagtaactagaatagcgcatggccttccagttggcggagacttg
gaatatgcggatgaagtgacgctctcaaaagcaatggaaggacgaagagaagtataa

DBGET integrated database retrieval system