KEGG   Listeria monocytogenes FSL R2-561: LMKG_00801Help
Entry
LMKG_00801        CDS       T01985                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00071  Fatty acid degradation
lmg00072  Synthesis and degradation of ketone bodies
lmg00280  Valine, leucine and isoleucine degradation
lmg00310  Lysine degradation
lmg00362  Benzoate degradation
lmg00380  Tryptophan metabolism
lmg00620  Pyruvate metabolism
lmg00630  Glyoxylate and dicarboxylate metabolism
lmg00640  Propanoate metabolism
lmg00650  Butanoate metabolism
lmg00900  Terpenoid backbone biosynthesis
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01120  Microbial metabolism in diverse environments
lmg01130  Biosynthesis of antibiotics
lmg01200  Carbon metabolism
lmg01212  Fatty acid metabolism
lmg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMKG_00801
   00630 Glyoxylate and dicarboxylate metabolism
    LMKG_00801
   00640 Propanoate metabolism
    LMKG_00801
   00650 Butanoate metabolism
    LMKG_00801
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMKG_00801
   00072 Synthesis and degradation of ketone bodies
    LMKG_00801
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMKG_00801
   00310 Lysine degradation
    LMKG_00801
   00380 Tryptophan metabolism
    LMKG_00801
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMKG_00801
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMKG_00801
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMKG_00801
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmg04147]
    LMKG_00801
Enzymes [BR:lmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMKG_00801
Exosome [BR:lmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMKG_00801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AEO25761
Position
complement(1464820..1465425)
Genome map
AA seq 201 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKNFLKKKLFL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaactttttgaagaagaaattattc
ctgtaa

DBGET integrated database retrieval system