KEGG   Listeria monocytogenes FSL R2-561: LMKG_00902Help
Entry
LMKG_00902        CDS       T01985                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00900  Terpenoid backbone biosynthesis
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01130  Biosynthesis of antibiotics
Module
lmg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMKG_00902
Enzymes [BR:lmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LMKG_00902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEO25664
Position
1363069..1364211
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKT
REQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttcaattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaaccaaaaatggtcgctgtttggcatacgaga
gatcgtgttaccttagaagcagaattcccaaatgtgaaattttttaatggtttagaagga
cttagagaagtagcgacctatttagatggggacgttcttttaaatgcagttatggggagc
gttggactacttcctacattagatgcaatcgaagctgggaaggccattgcaatagctaat
aaagaaacacttgtcacggctggacatttagttatgcgtgcggcgaaagaaaagaacatt
tctctattacccgttgatagtgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaaataattttgacagcgagcggtggaagtttccgagataagacg
agggagcaactcagcgcggttacggtgaaagaagcgttaaagcatccgaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtagattacgatgatattgaggtagttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactctatataccgtat
gaaaaagaattccggatcactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgttgctggctttttaaatggacaggtagctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagcatttctaatcct
gacttggatacgattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system