KEGG   Listeria monocytogenes FSL R2-561: LMKG_02770Help
Entry
LMKG_02770        CDS       T01985                                 

Definition
(GenBank) plcB protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00562  Inositol phosphate metabolism
lmg00564  Glycerophospholipid metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LMKG_02770
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMKG_02770
   00565 Ether lipid metabolism
    LMKG_02770
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMKG_02770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:lmg02042]
    LMKG_02770
Enzymes [BR:lmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     LMKG_02770
Bacterial toxins [BR:lmg02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   LMKG_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC S1-P1_nuclease NOGCT
Motif
Other DBs
NCBI-ProteinID: AEO24505
Position
211333..212211
Genome map
AA seq 292 aa AA seqDB search
MNDMKFKKVVLGMCLIASVLVFPVTIKANACCDEYLQTPAAPHDIDSKLPHKLSWSADNP
TNTDVNTHYWLFKQAEKILAKDVNHMRANLMNELKKFDKQIAQGIYDADHKNPYYDTSTF
LSHFYNPDRDNTYLPGFANAKITGAKYFNQSVTDYREGKFDTAFYKLGLAIHYYTDISQP
MHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVAKRFCSDDVKDWLYENAKRAKAD
YPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLEFWSKKTNE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatatgaaattcaaaaaggtggttctaggtatgtgcttgatcgcaagtgttcta
gtctttccggtaacgataaaagcaaatgcctgttgtgatgaatacttacaaacacccgca
gctccgcatgatattgacagcaaattaccacataaacttagttggtccgcggataacccg
acaaatactgacgtaaatacgcactattggctttttaaacaagcggaaaaaatactagct
aaagatgtaaatcatatgcgagctaatttaatgaatgaacttaaaaaattcgataaacaa
atagctcaaggaatatatgatgcggatcataaaaatccatattatgatactagtacattt
ttatctcatttttataatcctgatagagataatacttatttgccgggttttgctaatgcg
aaaataacaggagcaaagtatttcaatcaatcggtgactgattaccgagaagggaaattt
gacacagcgttttataaattaggcctagcaatccattattatacggatattagtcaacct
atgcacgccaataattttaccgcaatatcataccctccaggctaccactgtgcatatgaa
aattacgtagataccattaaacacaattatcaagcaacggaagacatggtagcaaaaaga
ttttgctcagatgacgtgaaagactggctctatgaaaatgcgaaaagggcgaaagcggac
tacccgaaaatagtcaatgcgaaaactaaaaaatcatatttagtaggaaattctgaatgg
aaaaaggatacagtggaacctactggagctagactaagagattcacagcaaactttggca
ggttttttagaattttggtctaaaaaaacaaatgaataa

DBGET integrated database retrieval system