KEGG   Listeria monocytogenes FSL R2-561: LMKG_03175Help
Entry
LMKG_03175        CDS       T01985                                 

Definition
(GenBank) siroheme synthase subunit family protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00860  Porphyrin and chlorophyll metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMKG_03175
Enzymes [BR:lmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     LMKG_03175
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     LMKG_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M RVP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEO25421
Position
1151056..1151535
Genome map
AA seq 159 aa AA seqDB search
MKYPIMLDITGKKVVIIGGGKVALRKITGLLDAGADILVVGLKILPEIKALDVRVVEEAY
RPEHLHAAFMIFICTDNLEVNQCVLRDREAGQLVNDTTDQANSDFFNMATVTKNELMVGI
STGGGNPGYAKKVKREVSQLVANLETEEIGRRNKKDKTC
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacccgataatgcttgatattacagggaaaaaggttgtcataattggaggcgga
aaagtggcgcttcggaaaattacgggtttgctggacgcgggtgccgatattttggtggtt
gggctaaaaattttgccagagattaaggcgctggatgtgcgggtagtggaggaagcttat
cgaccagaacatcttcatgctgcatttatgatatttatttgtacagataatttagaagta
aatcaatgtgttttgcgtgaccgagaagcaggacaactagtgaatgatacgactgaccaa
gcaaattctgatttttttaatatggcgacagtaacgaaaaatgaactaatggttgggatt
tcaacgggtggaggtaatccaggctacgcgaagaaagtgaagcgtgaggttagtcaattg
gtagcaaatttagaaacggaagaaatcggaaggcgtaataaaaaagataaaacctgctaa

DBGET integrated database retrieval system