KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_2949
Entry
LMHCC_2949        CDS       T00801                                 
Name
(GenBank) putative phage anti-repressor
  KO
K07741  anti-repressor protein
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    LMHCC_2949
SSDB
Motif
Pfam: ANT AntA DUF3152 Dor1
Other DBs
NCBI-ProteinID: ACK41280
Position
2928502..2929290
AA seq 262 aa
MSNLQVIANDMLPVLENEKGEKFVNARALHEKLMTTTKFADWIKRRIRQYGFVENEDFFS
LLKNEKRAIGGTTSIDYIFTLDSGKELAMVENTEQGRSIRKYFIEVEKQARKLATEYPTF
SYMIDDPVARAKKWIEEQQEKQEALKQIEEQKPKVVFAEAVQTSKNTILVKDLATILKQK
GLDIGQNRLFEWLRGSGYLLNKGAYYNKPSQKAMNLGLFEQKTHIHTDRNGLMITTYTPT
ITGKGQVYLLNKLLEEQNQVII
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcaaatttacaagtaattgcaaatgatatgttgccagtccttgaaaatgaaaaaggt
gaaaaatttgtaaacgctagagcattgcatgaaaaactaatgactacaactaaattcgct
gattggattaaaagacgaattcgccaatacggatttgtagaaaatgaagattttttctca
cttctcaaaaatgagaaacgagcgataggtggcactacatcaatagattatatctttact
ctcgactctggaaaagaattggcgatggtagagaatacggaacaaggtcgatcaattaga
aaatatttcattgaagtagaaaaacaagcgaggaaattagcaactgaatatccaacattt
tcatatatgatagatgacccagttgctagagctaaaaaatggattgaggaacaacaagag
aaacaagaagcattaaaacaaattgaagaacaaaagccgaaagtagtttttgcggaggct
gtacaaacgagtaagaacacgattttagtaaaagatttagctactattctgaaacaaaaa
ggattagatataggacaaaataggcttttcgaatggctgagaggaagcggttatttgcta
aataaaggggcttattataacaaaccgtcacaaaaggcaatgaatttaggattgttcgaa
caaaaaacacatattcatacagatagaaacggcttaatgataacaacctacacgccaaca
ataacaggaaaagggcaagtatatctattaaataaattattagaagaacagaatcaagtc
ataatttaa

DBGET integrated database retrieval system