KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0051Help
Entry
LMHCC_0051        CDS       T00801                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00260  Glycine, serine and threonine metabolism
lmh00750  Vitamin B6 metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh01230  Biosynthesis of amino acids
Module
lmh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMHCC_0051 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMHCC_0051 (thrC)
Enzymes [BR:lmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMHCC_0051 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: ACK38414
Position
47888..48943
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatttcacttgcggaaggaaatacaccacttatcccattaccgaatttgtccaaagaa
cttggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgtcgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggtaaagttgccttaggaaaattagcgcaagcagttatg
tacggagcagatattatctcgattcaaggtaattttgacgaagcattaaaatcggttcgt
gaattggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gctattccagtcggtaatgccggaaatatttctgcatactggaaaggatttaaagagtgg
aatgaggctaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacagcgattcgtatc
ggaaatccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgttaatgcctataaaaaaattgcagcgcaagatggt
gtcttcatcgagccaggttcagctgcttcattagctggtgtaatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagttgtttgtgtctttactggaaatgggttaaaagat
ccggatactgcgatgagtgtgcatgaaattccaatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system