KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0197Help
Entry
LMHCC_0197        CDS       T00801                                 

Definition
(GenBank) HAD-superfamily subfamily IIA hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00627  Aminobenzoate degradation
lmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LMHCC_0197
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LMHCC_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase YscJ_FliF Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: ACK38559
Position
194751..195524
Genome map
AA seq 257 aa AA seqDB search
MELKNYKAYLIDLDGTMYRGAEVIPEAIIFIENLKRAGIPYLFVTNNSTKTPGQVAEHLT
DMGIQAVSDDVFTTSQATVQFMMEQKREKTVYVIGERGIKQELTDNGFEITSSNPAFVVV
GLDREVDYEKFSKAALAVRGGAMFISTNGDAAIPTERGLLPGNGSITSVVSVATETAPVF
IGKPESIIMEQALAKLGVHKDEAIMVGDNYETDIMAGINYGMDTLIVHTGFTSKEALLTK
EIQPTYAVTKLTDWKFN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggaattgaagaattataaagcgtatttaattgatttagatggcacgatgtatcgcggg
gcagaagttattcctgaggcgatcatttttatcgaaaacttaaaacgtgcgggaattccg
tatttatttgtaacaaacaattcaacaaaaacacctgggcaagtagcagaacatttaact
gacatggggattcaagctgtaagtgacgatgtattcacgacgtcacaagcaaccgtgcaa
tttatgatggaacaaaaacgcgaaaaaacggtttatgttatcggagaacgtggaataaaa
caagaactaacagataatggatttgaaataacttctagtaatccagcttttgttgttgtt
gggcttgaccgggaagtcgattatgagaaattttcaaaagcagctcttgcggttcgcggt
ggcgcgatgtttatttcgacgaatggcgatgcagcaattccgacagagcgcggtttgctt
ccaggaaatggttcgattacatcagtcgtttccgtagccacagaaacagcaccagttttt
attgggaagcctgaatccattattatggagcaagcactcgcaaaactcggtgtccataaa
gacgaagcaatcatggtgggtgacaactacgaaaccgatattatggcgggcatcaattac
ggcatggatacgttaatcgtacacactggctttacatcaaaagaagcattattaacgaaa
gaaatccagcctacatacgctgtaacaaaactaactgattggaaatttaactag

DBGET integrated database retrieval system