KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0527
Entry
LMHCC_0527        CDS       T00801                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00550  Peptidoglycan biosynthesis
lmh01100  Metabolic pathways
lmh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMHCC_0527 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LMHCC_0527 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmh01011]
    LMHCC_0527 (murG)
Enzymes [BR:lmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     LMHCC_0527 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:lmh01011]
 Precursor biosynthesis
  Glycosyltransferase
   LMHCC_0527 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C UDPGT Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: ACK38884
UniProt: B8DBP8
Position
533639..534730
AA seq 363 aa
MKVAISGGGTGGHVYPALALIRELKKVHPEAEFLYIGTEKGLEAGIVKREGIPFEAIEIT
GFKRSLSLENIKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLI
HEQNSVAGLTNKFLSRYTDKVAICFEEVSDSFASEKIVFTGNPRASEVVGVDSEGALEAY
GLVSGKPTVLVFGGSRGARGVNEAVEAILPEWNNRDFQLLYVTGDVHYEKIKDSLAELNL
GYHISVQPFIYDMPKILNAVTLVVSRAGATTLAELTALGVPSILIPSPYVTANHQENNAR
ALEKNNAAIVITEAELKNTNLMATVDSILNDETKLNGMKLSAKQMGRPDAAAKLVEAVLS
IMK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaagtagcaataagtggtggcggtactggtggacacgtttatccagcgcttgctctc
atcagagaattaaaaaaagttcatcctgaagcggaatttttatatatcggaacagaaaaa
ggcttagaagctggaattgttaaacgggaaggtattccatttgaagcaattgaaatcact
ggtttcaaacgttcattatcgttagaaaatattaaaacagtgatgcgttttctgagcggc
gcgaaaaaaagtaaacaaattttgcgcgacttcaaaccggatgtcgttattggaacaggg
ggctatgtttgtggcccggtcgtttacgcagcagcaaaactcaaaattcctactttaatt
catgaacaaaatagcgttgctggtttaacgaataaatttttaagtcgttacacagataaa
gtagccatctgttttgaagaagtaagtgattctttcgcatcggaaaaaattgtttttact
ggtaatccacgtgcttctgaagttgtaggtgtggactcagaaggtgcactggaagcttac
ggacttgtttcaggaaagccaactgtacttgtttttggaggaagtagaggggctcgtggc
gtgaatgaagcggtagaagctattttgccagagtggaataatcgtgattttcagctactt
tatgtaactggggacgtccactatgaaaaaataaaagattctttggcggagttaaattta
ggttatcatattagcgttcaaccatttatttatgatatgcccaaaattttaaacgctgtg
acgttagttgtttcaagagctggagcaacaacactcgcagaactgacagcgcttggggtt
ccgagtattctgatacctagtccatacgtgacagcgaaccaccaagaaaacaacgcccgc
gctttagaaaaaaacaatgctgcaatcgtaattacagaagcagaattaaaaaataccaat
ttgatggcgacggttgattcgattttgaacgacgagacgaaattaaatggtatgaagtta
agtgctaaacaaatgggtcgcccagatgcagcagctaaattagtagaagcagttcttagc
attatgaaataa

DBGET integrated database retrieval system