KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0797Help
Entry
LMHCC_0797        CDS       T00801                                 

Gene name
purM
Definition
(GenBank) phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00230  Purine metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01130  Biosynthesis of antibiotics
Module
lmh_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LMHCC_0797 (purM)
Enzymes [BR:lmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     LMHCC_0797 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ACK39149
UniProt: B8DDZ0
Position
805704..806753
Genome map
AA seq 349 aa AA seqDB search
MAENAYSKAGVDVEAGYQVVERIKKHVARTERLGAMGALGSFGGMFDLSSLHLKEPVLVS
GTDGVGTKLLLAIEADKHDTIGIDCVAMCVNDILAQGAEPLFFLDYIATGKTDPVKMEQI
VKGVADGCEQAGAALIGGETAEMPDMYGSDDYDLAGFTVGAVEKQKLITEGAVKEGDTLI
GIPSSGIHSNGYSLVRKIFFKDNELTLDAEISELDVPLVEELLKPTRIYVKPVLEVLKEV
DVHGITHVTGGGFVENLPRMLTNDLAVKVELGSWPVLPIFDVMKKYGQLNEMEMYEIFNM
GIGMVLAVAKADVERTLEVLVQNGEAAYVIGEVTTRENDAVIFTGGTKG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaatgcatatagtaaagcaggcgtggacgtagaagctggctatcaagttgta
gaacgtatcaaaaaacatgtggctagaacagagcgattaggcgctatgggggcacttggt
tcatttggtggaatgtttgacttaagtagtttgcatttaaaagaacctgtccttgtttct
ggtacggatggtgttggtacaaaattacttttggcaattgaagcagataagcatgatacc
attgggattgactgcgtggcaatgtgtgtgaatgacattttagctcaaggcgccgagcca
ttatttttcttagattatatcgctactggaaaaacagatccagtgaaaatggaacaaatt
gttaaaggcgtggctgacggctgtgaacaagctggtgcggctttaattggcggcgaaact
gctgaaatgcccgatatgtacgggtcagacgactatgatttagcaggttttactgttggg
gctgtcgagaaacagaaactaattacagaaggcgcagtcaaagaaggagatacactcatt
ggaattccatctagcgggattcatagtaatggttactccctagtgcgcaaaattttcttt
aaagataacgaattgacactcgatgcggaaatcagtgaactagatgtgccacttgtggaa
gagctacttaaaccaacacgtatttatgtcaaaccagttttagaagtattgaaagaggta
gatgtgcacggaattacgcatgtgacgggtggcggatttgtagagaatttaccacggatg
ttaacgaatgatttagctgtgaaagtggaactaggttcatggccagtgttgccgattttt
gacgttatgaagaaatacggccaattaaacgaaatggaaatgtatgaaattttcaatatg
ggtattggtatggtgttggcagttgcgaaagcggatgtggaaagaacattagaagtactc
gtccaaaacggagaagcggcttatgtaattggcgaagttacgacacgtgaaaatgatgcg
gttattttcacaggaggaacaaaaggatga

DBGET integrated database retrieval system