KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0879Help
Entry
LMHCC_0879        CDS       T00801                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase 2 (GSA 2)(Glutamate-1-semialdehyde aminotransferase 2) (GSA-AT 2)
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00860  Porphyrin and chlorophyll metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMHCC_0879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmh01007]
    LMHCC_0879
Enzymes [BR:lmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LMHCC_0879
Amino acid related enzymes [BR:lmh01007]
 Aminotransferase (transaminase)
  Class III
   LMHCC_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACK39230
UniProt: B8DFN7
Position
complement(893295..894593)
Genome map
AA seq 432 aa AA seqDB search
MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGGIPVTMERASGAYFYDVDGNKYIDYLA
AFGPIITGHAHPHITEAITKAAQNGVLYGTPTKHEITFAKMLKEAIPSLEKVRFTNSGTE
AVMTTIRVARAYTGRDKIIKFAGCYHGHFDLVLVEAGSGPSTLGIPDSAGVTKSTAEEVI
TVPFNDLASFKEALAVWSDQVAAVLVEPIVGNFGMVAPEDGFLEAVNELAHANGSLVIYD
EVITAFRFMYGGAQNYLGVIPDLTAMGKIIGGGLPIGAYGGRVDIMEKVAPLGPAYQAGT
HAGNPASILSGIACLEVLQEEGLYERFEKYGSMLKDGIEKAALKHGIAVTVNQIVGALTV
YFTEDPVTNYAEAGATNGELFGRFFKGMLEEGINLAPSKYEAWFITSAHSEADILETIQA
VDTVFGKMVQDN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcattcaatgtcaaaaaaattgcatgatgaagcacttttacatatagttggcggg
gttaatagcccatctaggtcaaataaaggagttggtggcggaattcctgtaacaatggaa
cgggctagtggcgcttatttttatgatgtggatggaaataaatatattgactatttagct
gcatttggaccaatcattacggggcatgcacatcctcatattacagaagcaatcacaaaa
gctgcacaaaatggcgttttgtacggaacgcctacgaaacatgagatcacttttgcaaaa
atgttaaaagaagccattccttcgcttgagaaagttcgttttacaaattctgggacagaa
gctgttatgacaacaattcgtgtcgctcgcgcttatacaggcagagataaaatcattaaa
ttcgctgggtgttatcacggtcattttgatttggtgctcgtggaagctggttctggacct
tctacgcttggcattcctgattctgcaggggtaacaaaatcaaccgcagaagaagttatt
actgtaccttttaatgaccttgcatcgtttaaagaggcattagctgtttggagcgatcaa
gttgctgctgttttagtagagccaattgttgggaattttggaatggttgcaccagaagat
ggatttttagaagcagttaatgaactcgcacatgccaatggttctttagtaatttatgat
gaagttattaccgctttccgttttatgtacggcggcgcgcagaattacttaggcgttatt
ccagacttaactgctatgggtaaaattattggtggtgggcttccgattggtgcttacggt
ggacgagttgatatcatggaaaaagtagcaccgctcggaccggcttatcaagctgggacg
catgctgggaatccggcttctattctttcaggaatcgcgtgtctcgaagttttacaagaa
gaaggactgtatgagcgctttgaaaaatatggctcgatgctgaaagatggtattgaaaaa
gctgcgctaaaacacggcatcgctgttacggttaaccaaattgtcggtgctctaactgtt
tattttacggaagatcctgtgactaattatgctgaggctggcgctacaaatggcgagtta
ttcggtcgtttctttaaaggaatgttagaagaaggcattaacttagcaccttctaaatat
gaagcatggttcattacatccgcgcattcagaagcagatattttagaaacaatccaagca
gttgatactgtttttggaaaaatggttcaagataactag

DBGET integrated database retrieval system